CAZyme Information: MGYG000003771_00778

Basic Information

• Species: Blautia sp002161285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp002161285
• CAZyme ID: MGYG000003771_00778
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000003771_21|CGC1	54894.1	4.6672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003771	3602220	MAG	Canada	North America

• Gene Location: Start: 13608; End: 15083 Strand: -

Full Sequence      

MTKITLNTGSLSFLREMDSRLISYNIEMTEVTGGTFWKLYTPAQIEGKEEVPQLADLSQM
GSLLEMFPPADLRDQRALELAKALGPAYIRVSGSWATTTYYDLDGHTGGKVPEGFHSILT
RKQWNLLLDFVKYVDGKLLISPANCDGVRNPDGTWNPGQLKLLLDYSRDYGVPISAVEFM
NEPNTTILGGTPSNYTPEDFSRDQDLCFRFLKENYPDILTVGPCSSGEKFSPYVGYHNLS
VIPSEDLLEGCKEQADVYSYHMYNCFSERGAFLGIHWPGDKALSEEYLGIPWEAACYYKK
LRDQYCPGAQMWVTESGDAGCGGNTWASTFLDVIRSADELGRFCTVTDGVIFHNTFMASD
YGYLDFETHLPRPNYWLALLWNRLMGSKVYDLGQEIREGFHCYVHSRKDGKKGYAYMIVN
NSPSEAALLEVPWRGTVYTLSAEYLRSPRILLNGKPLELTGTAQLPSLEGAPVEAGTLTL
APATVTFLVTD

Enzyme Prediction     

No EC number prediction in MGYG000003771_00778.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	69	489	1.1e-68	0.9406593406593406

CDD Domains     

MGYG000003771_00778 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXI08463.1	8.13e-173	4	489	5	503
QGS68324.1	8.13e-173	4	489	5	503
SNU86930.1	2.94e-171	4	489	5	506
AEN98036.1	1.01e-164	10	489	11	508
SQG83426.1	4.00e-159	1	489	1	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E8M_A	3.34e-12	138	476	18	365	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5LA4_A	4.92e-12	138	476	138	485	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
7RG8_A	7.83e-12	116	476	6	363	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5L9Z_A	7.91e-12	138	476	18	365	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FF10	6.30e-18	71	469	76	512	Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
Q8L608	1.96e-17	153	476	169	513	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
X4Y2L4	2.93e-16	71	489	41	478	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
Q9LRC8	5.36e-13	153	474	182	493	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
B2RY83	1.06e-12	116	489	185	580	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003771_00778.