CAZyme Information: MGYG000003765_01515

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_01515
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		44092.2	9.3386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 1202; End: 2377 Strand: +

Full Sequence      

MRYLYPVVPLLFFLSVVSCAEQQRSDVTPWGSALGQDTVPSNSAFGLNDIINNGEIIMLT
ISGPETYYDYHGKGMGLQYLLCEQFAQALGVSLRVELCRDTTELITRIKNGDGDIVAFQL
PQTLKGVCFAGATQNSGKTGWAVQPDNKELADTLNRWFKPEMIAEITQRERFLLSTRSVT
RRVYSPMLNRSQGIISRYDHYFQRYAPIARWDWRLMAAQCYQESTFDPMAQSWAGARGLM
QIMPATATHLGLPLGSIHNPEDNIAAAAKYIKELNARFADVPASERVSYVLASYNGGHYH
IRDAMALARKNGKDPNRWENVKEFVLKLSSPAYYRDKVVKYGYMRGSETVDYVEKINSRW
AQYRGVARGGSGAFMSPSVPERAKRGNRWSI

Enzyme Prediction     

No EC number prediction in MGYG000003765_01515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	210	358	2.3e-27	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	8.87e-78	202	364	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	3.13e-47	47	356	36	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.01e-45	54	356	23	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	3.89e-23	222	318	30	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	4.24e-23	212	314	11	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28026.1	7.65e-198	1	391	22	413
ALO48082.1	3.58e-186	11	391	9	391
EFC70077.2	2.82e-176	10	391	9	391
VEH15587.1	3.73e-172	1	391	28	433
QUB48180.1	1.45e-171	1	391	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.81e-23	192	356	253	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.93e-23	192	356	260	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.93e-23	192	356	260	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	2.19e-23	192	356	246	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.19e-23	192	356	246	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.72e-32	50	356	37	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q47XX8	5.79e-28	42	356	24	435	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
A0KJ50	1.92e-27	47	356	40	446	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A1U3J1	5.10e-27	195	356	283	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q2NS21	5.12e-27	38	356	25	443	Membrane-bound lytic murein transglycosylase F OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000138	0.122278	0.877441	0.000049	0.000057	0.000050

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_01515.