CAZyme Information: MGYG000003762_01358

Basic Information

• Species: Corynebacterium aurimucosum_C
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium aurimucosum_C
• CAZyme ID: MGYG000003762_01358
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		33795.26	9.9785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003762	2238677	MAG	Canada	North America

• Gene Location: Start: 3478; End: 4410 Strand: -

Full Sequence      

MFLAVLAIVVMIFRERGVKMTPAAVLVAVLLTALTPANEAMHGSLYYGQVNVFLMLLVAL
DFLPLKHRLPGVGIGLAAGIKLTPAYMGLALLFEKRWWAAAGAVITFLVTVVLGFLFVPD
AMDFWTDAMFNSSRVGEHANPGAKSLRSLMYRVLGVDGGIWWLLAVIVVFALTCLALRTA
YLRGNRSAAFALTGLSTCLVSPFSWYHHFVWTIPFVVMVFVSVNQALSTRLSGKFGEQLA
GLASVAALFVVSLPFMSVPVWFTMSTANLDAIESFQPWATSLWTLSCVAFIAVYAVWGFV
APRKRAAEKS

Enzyme Prediction     

No EC number prediction in MGYG000003762_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	2	202	1.2e-53	0.8658008658008658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	5.79e-32	27	217	132	324	mannosyltransferase; Provisional
pfam09594	GT87	8.03e-20	2	202	31	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU96335.1	1.44e-212	1	310	98	407
QQU92048.1	4.79e-211	1	310	98	407
ACP33863.1	4.79e-211	1	310	98	407
AJI79851.1	7.48e-193	1	306	98	403
VEG06904.1	1.17e-189	1	306	98	403

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R2K8	1.29e-21	27	301	143	403	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	5.28e-21	28	217	158	349	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	5.28e-21	28	217	158	349	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1
P9WMZ8	3.32e-18	28	219	145	341	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	3.32e-18	28	219	145	341	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	38
43	65
70	92
97	119
159	181
188	205
209	228
241	263
278	300