CAZyme Information: MGYG000003744_00639

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003744_00639
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000003744_65|CGC1	43749.5	9.5972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003744	2038806	MAG	Canada	North America

• Gene Location: Start: 3761; End: 4936 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGSNLMKGLYAEDPGADIRFWGGGLMDAVFHARQPGDGLVQDYRTG
ALIGFTQVLLRARKFARRIAACEADIRRWKPDVVILIDYPGFNFRIAEFAHKAGFKVFYY
IAPKVWASRENRVRKLKAFVDKLFIVFPFEISYFKKKGVDFRYEGNPLVDAVDSSSALQE
SRAEFLAATGLPDRPLIALLAGSRNGEISTMMPTFMAFADRMHALPEYARWQFVVAAAPG
RTAADYAPWLTDIPARADYVHMVSGRTYSVLRQARAAVVNSGTASLECALIGTPQVVAYR
VSPVNYWIGRKIIKVNFISLGNLILNRTCFRELLQEYFTPDNVLAEVRRLLEDAEYRDRM
LAGYREIREALGGTGTAAAVARAMIAELKAE

Enzyme Prediction     

No EC number prediction in MGYG000003744_00639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	371	3.7e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.47e-114	1	371	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.59e-103	1	373	2	364	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.40e-83	4	372	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.79e-70	5	372	10	370	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.25e-49	1	372	2	333	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	1.41e-108	1	389	1	374
SNV26174.1	1.41e-108	1	389	1	374
QRO51639.1	2.00e-108	1	388	1	373
AZS31618.1	2.28e-107	1	388	1	373
AGY53532.1	1.48e-105	1	389	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.17e-42	5	369	11	363	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.27e-42	5	369	11	363	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	3.89e-73	2	381	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	3.29e-71	2	375	8	367	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	8.76e-68	5	377	8	367	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	3.54e-67	2	381	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.91e-66	2	385	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999354	0.000674	0.000028	0.000002	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003744_00639.