CAZyme Information: MGYG000003736_02092

Basic Information

• Species: Cupriavidus metallidurans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Cupriavidus; Cupriavidus metallidurans
• CAZyme ID: MGYG000003736_02092
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		41122.9	6.8344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003736	3680628	MAG	Canada	North America

• Gene Location: Start: 8942; End: 10075 Strand: -

Full Sequence      

MVAGEASGDLLASLLLEGLRARLGESVDYAGIGGHRMMAQGFVSHWPMETLSVNGYVEVL
GSLREILATRREIREQLLARPPLCFIGVDAPDFNFGLEVPLRRAGIPVVHFVSPSIWAWR
GGRIRTIARAVDHILCLFPFEPEIYAKAGIPATYVGHPLADVIPMVPDVAGARAKLDLPE
GKRIVAVLPGSRQSEVRNLGATFFAAMDRMHRMDGNLAFVLPVASAPLREIVAGLHAQYP
DIDLTVVDGQSHLAMESADVVLLASGTATLEAALYKKPMVISYKVPWLTAQIMKRQGYLP
YVGLPNILSGRFVVPELLQDDATPEALARETLLQLNDEGNIAFLRQHFTTMHETLKRDTA
KLAAGVVVDLMRSRGVV

Enzyme Prediction     

No EC number prediction in MGYG000003736_02092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	356	2.1e-126	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	0.0	1	375	6	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.83e-147	1	372	6	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.82e-96	1	367	3	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.33e-93	1	367	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	7.40e-42	3	328	233	563	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP09549.1	1.97e-272	1	377	25	401
QGS30692.1	1.97e-272	1	377	25	401
QWC89898.1	1.97e-272	1	377	25	401
ABF08331.1	1.97e-272	1	377	25	401
AVA33549.1	9.35e-271	1	377	25	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.80e-79	1	370	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.06e-79	1	370	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1LNE5	3.94e-273	1	377	25	401	Lipid-A-disaccharide synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=lpxB PE=3 SV=1
Q470F0	8.57e-243	1	377	26	402	Lipid-A-disaccharide synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=lpxB PE=3 SV=1
Q8XZH8	1.11e-205	1	375	14	388	Lipid-A-disaccharide synthase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=lpxB PE=3 SV=1
B2T5I1	8.09e-163	1	374	12	385	Lipid-A-disaccharide synthase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=lpxB PE=3 SV=1
Q13XC9	3.28e-162	1	374	12	385	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003736_02092.