CAZyme Information: MGYG000003723_01751

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Mobiluncus
• CAZyme ID: MGYG000003723_01751
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		60355.68	9.6225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003723	2071852	MAG	Canada	North America

• Gene Location: Start: 3917; End: 5509 Strand: +

Full Sequence      

MVAFLVFLTRVVRLGAIKTLIFDETYYVKDAYGLIKRGYEVQWPKDFDPTFISGSFKTPL
EGSFVVHPTVGKWLIGLGIKLFGNQPFGWRIAVCVAGAVAVYLVGRIVWELFGNASMATL
ASVLMGLDGVQIALSRTAILDIFLEMFILLGVLYVIRDQLSYRPRLIADLQDIDAARHTE
QLRQRFRRAGSESAETLPGSKHRAAGLGVAPNYSRFVLSWGPSYWWRPWLFAAGIAFGLA
MSVKWSGLYVVAVFGIFVFIRELSARWRTEPRWIGSSVLTGGLPAFVNLVPIAFLTYVVS
WMGWFTHSQAWGHTNRGLVADWLDYHRQIFVFHTNLDATHPYMANPWGWLLQLRPTSFYY
EGVPGDCGASRCIEAVNSLGNPILWWVGFVAFILVMVAAFGFLDWRAGLIFTGYMATWLP
WLVYSNRTIFTFYTVVISPFMIMAVVYLLGLLMGAWRITKDRNWTGRYNLVPDLSQVSRG
EFITALVIIVFIFVAAVFFFPIWTGMPMPEDHYGWRMWLNNPDTKWAYWI

Enzyme Prediction     

No EC number prediction in MGYG000003723_01751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	2	305	4.3e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4346	COG4346	8.40e-12	67	448	136	405	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.25e-11	5	261	33	226	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.80e-11	321	520	500	691	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	5.87e-06	1	268	2	206	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam16192	PMT_4TMC	0.002	320	520	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT14111.1	0.0	2	530	26	554
QQU09498.1	0.0	2	530	26	554
ADI66786.1	0.0	2	530	26	554
QGS11599.1	3.58e-122	8	521	81	579
QCT34948.1	5.05e-122	8	521	81	579

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.74e-50	8	521	50	514	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	2.63e-49	1	521	49	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.63e-49	1	521	49	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	3.05e-45	19	521	61	518	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.933854	0.065453	0.000283	0.000133	0.000096	0.000193

TMHMM  Annotations     

start	end
87	109
134	156
229	260
273	295
383	402
407	424
429	451
482	504