CAZyme Information: MGYG000003717_00453

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000003717_00453
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22969.13	8.1941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003717	1753680	MAG	Canada	North America

• Gene Location: Start: 47305; End: 47907 Strand: +

Full Sequence      

MFKFIRRMLVLAVLLFAGYKAYHIRQDVKQVMTYQPMVREILSERDTPANEELVLAMIYT
ETKGKERDVMQSSESASGTTNTIDDDAASIRQGIQTLTDNLYLAQNKGVDVWTAVQAYNF
GPAYIDFIAQNGKENTLALAKRYSRETVAPILGNTTGKTYTYINPISIFHGAELYENGGN
YYYSRQVRFNFYIMKFFNFF

Enzyme Prediction     

No EC number prediction in MGYG000003717_00453.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.39e-84	28	190	1	164	Lysozyme-like.
cd16891	CwlT-like	1.74e-65	34	187	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	4.70e-06	1	198	93	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCZ57684.1	4.54e-138	1	200	1	200
VTS70726.1	1.70e-133	1	200	1	200
QLL95816.1	6.94e-133	1	200	1	200
QXW60630.1	1.99e-132	1	200	1	200
BAV79927.1	2.83e-132	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	3.82e-19	30	187	23	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	4.89e-16	30	187	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	7.99e-118	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	1.61e-117	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
P0DC90	9.37e-69	14	195	13	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	9.37e-69	14	195	13	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	1.33e-68	14	195	13	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.891949	0.050762	0.056103	0.000250	0.000143	0.000807

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003717_00453.