CAZyme Information: MGYG000003714_03249

Basic Information

• Species: Enterococcus_A gilvus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A gilvus
• CAZyme ID: MGYG000003714_03249
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211		23781.02	7.967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003714	3507168	MAG	Russia	Europe

• Gene Location: Start: 2966; End: 3601 Strand: -

Full Sequence      

MLKLIGKILKVILTFAILVTLAIAGLFAFRTYTTTKTINSHREDVQLLADQAGVGNYTDV
ILGIMYTESKGKGTDLMQSSESAYGSRGKILSQQESIESGVKHFAESYQQAKAAGCDLDT
AIQAYNFGTKYIQFVKERGGKNSVELAEEYSRDVLSPGYGNDQQHMYRYMQMQSIMYNGG
YLYQNGGNMFYAEIVQMNKRFITFFQRFENS

Enzyme Prediction     

No EC number prediction in MGYG000003714_03249.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.25e-69	36	198	2	164	Lysozyme-like.
cd16891	CwlT-like	2.33e-66	41	198	1	149	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG37868.1	4.16e-144	1	211	1	211
BBM18601.1	1.10e-123	1	211	1	211
QXJ60416.1	3.16e-123	1	210	1	210
QZO10012.1	3.16e-123	1	210	1	210
AYQ23679.1	1.29e-122	1	211	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	2.12e-22	33	195	21	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.78e-17	41	195	27	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99ZN9	7.31e-34	59	198	51	189	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	2.90e-33	59	198	51	189	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	2.90e-33	59	198	51	189	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q8DPY9	3.31e-33	17	211	10	203	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q9AHT6	3.31e-33	17	211	10	203	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.976752	0.014979	0.001389	0.000098	0.000055	0.006761

TMHMM  Annotations     

start	end
7	29