CAZyme Information: MGYG000003701_02954

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_02954
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		35273.71	10.0713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 44263; End: 45168 Strand: +

Full Sequence      

MKSVIRIICLLFFITAFAGAATQRKIPSYEKYIKTYSTLAVEQQKKYKIPASITLAQGLL
ESGAGQSSLARRSNNHFGIKCHSDWRGGRVYHDDDLRGECFRKYKRVEDSYEDHSKFLKR
SRYESLFRLKITNYKGWAKGLQKCGYATDRAYANKLIKVIEDYELYRYDSGKVHKLTRKE
RKKLKFPVVKYTIYKTFGLLYVYAKDNDSFDQIAQNLDFPVKDLKKFNEVPEDFPLDKGD
IVYLEKKKKKADKPHYDHVVQIGESMHSIAQKYGIQIKSLYKMNKKDKDYVPEEGDVLKL
R

Enzyme Prediction     

No EC number prediction in MGYG000003701_02954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	165	1.3e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	2.85e-37	30	169	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	5.79e-35	30	172	44	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	1.69e-27	39	165	3	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.75e-25	28	169	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	3.04e-19	49	160	172	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY57337.1	6.86e-165	8	301	10	302
QUT21858.1	6.86e-165	8	301	10	302
BBK92151.1	6.86e-165	18	301	20	302
QUT55553.1	6.86e-165	8	301	10	302
AST54914.1	6.86e-165	8	301	10	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.13e-10	27	169	27	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	4.13e-09	31	181	62	224	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.13e-08	40	160	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.31e-08	40	160	13	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	8.37e-08	40	160	13	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.30e-15	25	170	44	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	3.10e-12	22	164	153	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	8.60e-09	20	171	152	317	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	1.81e-08	31	181	322	484	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	1.45e-07	51	284	202	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001034	0.997096	0.001284	0.000189	0.000190	0.000184

TMHMM  Annotations     

start	end
5	22