CAZyme Information: MGYG000003701_02461

Basic Information

• Species: Parabacteroides sp003480915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003480915
• CAZyme ID: MGYG000003701_02461
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000003701_5|CGC4	38795.71	7.7371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003701	6084075	Isolate	China	Asia

• Gene Location: Start: 84181; End: 85164 Strand: -

Full Sequence      

MKINLISTDVEIFKKQLSSNWKTDGYEFFFNSQEDIVWDSVIVYENINQYYHLKCRKGGF
FFISGEPPIVKVYSRSFLTLFDHVISAHKLKHLNNHRDQQALPWYFGYNFREKSPSFSYE
EIEQMDVPLKRKKISFITSTRTFLPGHKERLRFLKRIQSEFGDDVDFYGRGINIVDDKAD
ALLQYKFSICIENSCINDYWTEKIADPFLAYTVPIYYGCKNIKRYFPENSVRLIDIQDVK
EAIDEIGAIIANADSIYNEMLPSIKESRNRLLFVYNIFPFVIAYINKYIDISSKEIVEKE
ITPYVMYPVNIVDDMLLRMKRILLKRF

Enzyme Prediction     

No EC number prediction in MGYG000003701_02461.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	63	261	2.8e-29	0.5677233429394812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	8.86e-07	146	238	14	109	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO15364.1	7.34e-143	1	327	5	331
ABR44498.1	7.34e-143	1	327	5	331
QUT21271.1	1.40e-140	1	327	5	331
QFS96710.1	8.06e-51	26	278	30	281
QFT03025.1	8.06e-51	26	278	30	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	8.63e-12	110	246	160	294	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.01e-11	110	246	160	294	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	6.19e-11	110	246	160	294	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q5F2N3	1.10e-06	163	234	245	305	Alpha-(1,3)-fucosyltransferase 10 OS=Danio rerio OX=7955 GN=fut10 PE=2 SV=3
Q9LJK1	2.06e-06	177	261	255	340	Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1
Q9FX97	4.91e-06	177	261	266	351	Putative fucosyltransferase-like protein OS=Arabidopsis thaliana OX=3702 GN=FUT12 PE=2 SV=1
Q9VLC1	8.02e-06	182	269	232	320	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003701_02461.