CAZyme Information: MGYG000003684_00908

Basic Information

• Species: Eisenbergiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella massiliensis
• CAZyme ID: MGYG000003684_00908
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000003684_2|CGC8	43123.34	4.8076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003684	6691925	Isolate	China	Asia

• Gene Location: Start: 440934; End: 442049 Strand: -

Full Sequence      

MENNMKIRGVNLGNWLVLEKWMSPALFEGTKAEDEDALCRELPRQELIERLTAHRGSYIT
REDFIYISERGLNMVRIPVPHFIFGDDPVYCEPYVPCIEYLDRAFDWAGETGLQILIDLH
TAPESQNGFDNGGICGVCKWAQSPERIDRVLKVLGMLAERYKSHPALWGIQLLNEPISEP
LWQMIRSRYLPQDPERAAGSSFVPLEVLYDFYTRGYHMLRSILPPDKKIVFHDGFRFEVW
DTFFREAGFENVVLDAHWYLGMGQPDEDTDELSYMNAILKEDVKKLKRMEAVVPVIIGEW
CLSHNLKPGREYSALEKQLSYRLIGDAQLMAWESASGYFFWSYKLLSQPEGWDFRKCVEK
GWLPDNLEKGF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	344	2e-105	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.00e-25	6	189	17	207	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	8.74e-06	56	343	21	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	1.46e-134	6	366	3	369
AWY98291.1	1.07e-124	5	364	1	386
QRT49144.1	1.04e-123	5	364	1	386
QJU19071.1	3.71e-120	5	369	1	391
QQR01615.1	4.91e-120	5	364	1	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.22e-109	5	367	1	390	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.79e-108	5	367	1	390	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PF0_A	2.17e-39	2	364	11	385	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	3.74e-39	2	364	5	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.19e-39	2	364	11	385	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	1.05e-52	3	364	27	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	1.05e-52	3	364	27	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q96V64	2.52e-51	3	368	33	408	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
Q0CR35	1.52e-50	7	368	40	407	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
A2RAR6	1.76e-47	7	364	42	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003684_00908.