CAZyme Information: MGYG000003682_00038

Basic Information

• Species: Ruthenibacterium lactatiformans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruthenibacterium; Ruthenibacterium lactatiformans
• CAZyme ID: MGYG000003682_00038
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000003682_1|CGC1	45913.61	7.6252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003682	3961825	Isolate	China	Asia

• Gene Location: Start: 38188; End: 39450 Strand: +

Full Sequence      

MVTLILTRIVFVLSIPLCLYAVYFGVVALFGLRKKLPAAPQAKPEKRFALVVAARNEAAV
IGHLVDSLYGQDYPRELYEVIVAPNNCTDDTEAVAAGRGARIFCPEGVIRSKGEVLTQVV
DKIVLAEEFDAMCVFDADNLVDGQFLARMNDALVSGAQVAQGFRDSKNPEQSAISGCYSI
CYWMLNRFYNGARSALHLSALVNGSGFAVTTALLRRLGGWHTVTMTEDYEFSAQCAMLGE
RVHFVPEALIYDEQPLTFRQSWKQRRRWTTGSLQGLQNYGHGLFSSFVLHGSLICLDMYL
TFLVPMVQLASVVLGIAGLVLTLLGSGITFGGIMLHGMMLAALMTAGGFVASVVGSAVFA
AFTVALKNESLSGMAKGILAYWVFLMSQMVLTLLSFVKKQEKWEPIAHTSAKRLEDMRTA

Enzyme Prediction     

No EC number prediction in MGYG000003682_00038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	47	270	1.8e-29	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.25e-55	51	231	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	5.88e-36	1	398	1	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.54e-34	50	228	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	1.08e-25	20	275	2	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam13641	Glyco_tranf_2_3	1.65e-25	47	268	3	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX65217.1	1.67e-102	5	417	11	421
ADO38773.1	3.22e-99	11	417	10	410
ARD65366.1	3.22e-99	11	417	10	410
ALU13522.1	3.22e-99	11	417	10	410
QCT71577.1	3.22e-99	11	417	10	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	6.59e-10	14	266	4	260	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	6.62e-10	14	266	5	261	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.67e-17	47	272	50	280	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	7.50e-13	44	279	106	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	3.01e-11	49	279	109	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	1.25e-10	49	279	109	341	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P75905	1.38e-06	39	274	68	302	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
280	302
312	334
341	363
378	397