CAZyme Information: MGYG000003679_01994

Basic Information

• Species: Treponema_D sp002449305
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp002449305
• CAZyme ID: MGYG000003679_01994
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		37472.98	4.8363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003679	2427938	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 1048; End: 2067 Strand: -

Full Sequence      

MLELNVNTKSPAAITAALKKIKEMISTGTVAKDTAIHLILEPGSYRETVRYNLSNPLAIE
SVPGTKTEDCVILADNCEAYNKGQQNRAVFSFGPNATNVSLKNFTISNTHVKTSEELYSA
ADSAEALAWNNTTGTLFCEGIKLEGHQNTLFVKGFSWFLNSSISGDVDFIYGEPDTCLFE
NCAIEVVADNRGDFDGFAINSHAIAEKNGFVFTNCRFLGEKRKKNLVYACRTDGAGSSES
KKDWDSIAFVNCIFSDTYAPELLWDDDMSLEVYPRGNAKCGIREYNSKIALKGGKVAEAD
TSRRNIKSYTLTEDDYFNGYASRYLILHDTPFAELLSKE

Enzyme Prediction     

No EC number prediction in MGYG000003679_01994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	14	288	6.7e-31	0.8402777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.06e-12	12	226	99	325	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PRK10531	PRK10531	7.06e-11	27	217	140	333	putative acyl-CoA thioester hydrolase.
PLN02708	PLN02708	5.02e-09	105	271	338	503	Probable pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	6.24e-09	9	219	75	279	pectinesterase family protein
PLN02197	PLN02197	9.07e-08	58	222	293	482	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA01087.1	1.98e-171	1	335	1	335
QOS41182.1	3.68e-152	1	336	1	336
AEE17955.1	8.53e-69	27	339	47	361
AJQ92545.1	1.68e-23	30	323	521	802
QJR80763.1	2.11e-23	30	287	1382	1654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	3.06e-06	31	220	30	230	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003679_01994.