CAZyme Information: MGYG000003678_01897

Basic Information

• Species: CAG-95 sp900553305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900553305
• CAZyme ID: MGYG000003678_01897
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000003678_277|CGC1	35316.56	7.737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003678	2408138	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 16996; End: 17922 Strand: -

Full Sequence      

MLKYDVIIPVYRPGEKLNKLINALLSQTLLPRKIILINTEREEFLKFSSEEAFLAHSPLL
ELHHIKKAEFNHGATRNYGVSLSDAPFFVCMTDDAIPAGNAVMEELLKPFASESIGVSYA
RQLPAPDCGIIERYTRSFNYPETAGIKTAKDLPELGIKTFFASNVCAAYRRSYFNALGGF
TDHTIFNEDMIYARHLIDNGYAISYSAKAEVIHSHNYSGTEQFHRNFDLGVSHAQFQEEF
SEIKAEAEGKKLVLQTCRYLMKLHKPWLIVKLIWQSGCKYIGYSLGKSYQKFPMWFVKWC
SMNQSYWE

Enzyme Prediction     

No EC number prediction in MGYG000003678_01897.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.73e-11	5	174	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	5.09e-11	6	223	7	229	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	1.60e-10	3	211	55	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.87e-10	6	185	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG0463	WcaA	5.48e-10	1	225	2	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX25912.1	1.77e-113	3	307	6	304
QRO35954.1	3.56e-113	3	307	6	304
QBF76183.1	3.56e-113	3	307	6	304
QBE96877.1	5.88e-105	6	307	8	304
QMW79879.1	5.88e-105	6	307	8	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	2.14e-55	2	308	1	303	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003678_01897.