CAZyme Information: MGYG000003674_00384

Basic Information

• Species: Prevotellamassilia sp900772575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900772575
• CAZyme ID: MGYG000003674_00384
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1117	MGYG000003674_51|CGC1	122190.47	5.7519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003674	2595876	MAG	Peru	South America

• Gene Location: Start: 13275; End: 16628 Strand: -

Full Sequence      

MKRHYLYLGLASLMAALPAQAQTSIGFESETGYKRIGVYDNWPQSPFRTGALAGNVQVLD
NHLNAPDETFNGKAPNATAKILGLQRSRFGSNTFGARIDLNEPFTLSPTTRYVHVLINKP
REGRVMLIGLGKRTDRTGQSAETEQFWVLSSKKVTPDKWCDAVFPVKGAEGVEIHSLVVV
PDCESTHDLTGDFAAYIDQIELDDSSAERIVYGDYPINYDADSKLDRPDRYTNTVTLNSP
SGGAQTLTVGQQTSKLLYTQLLSKSLSAKAGETVKATAGFSTDWMHTYIYVDTGQDGRFS
NTLNDDGTPAAGSDLVAYSYYKQKNSKGETANPGTAIAPPAFTLPADLKEGFYRIRFKVD
WDNIDPAGSNDSGNPIVGNGGAIIDTRLNVHGDEVTISRVGGLNGDLTDGNGKDLTTVKA
PFGKPFTIMAKPAPDFELSHIRVRHGHHLDGDSLIHGTPQYVDEIYPAYTFKKGQLTLPA
EIIDGDVILEPYFINPGVKPSPTGEDYPLNFPADLPAKRTDRQLASFMLKATKGGTTAVS
IPQAQRAAVYADMRSKQVSVVPGDEIATTINYTGSGMHAYLYVDLNQDGQFSSTLNANGT
PTISGELVSYTYYNGLNSLGQKIADSDTKLQSLPAFTIPAVLPEGVYRARLKIDLDNIDP
AGQYAQGGTQNQIDDNGGAIVDFLINVHKEKHKLTVHTVNGSVTGTGTTGLPPTVTPFSA
LSIAPKPFASGFKAQSITIRHGHNLDGEQYVHGNRQWSEYKRAYAAAITLPKDSVDGDVV
ITADFQPDGTQQYELVFSDEFDGADGSMPDAKKWTRCDRQHPTWKRFLSINDAEHKLTGY
IEDGEFVARCLPNPFKETDNVDMISGGIETSGKFSFQYGKIEARLMTNPHTGNFPAFWLM
PQSPAEGWPYCGEIDIWEQIDAQDISHHTIHSKWANSKADGPECQGQSNNPTKTGTNTTP
VGNYHVFGLERTDKMMSWYVDGKKVFSYAKSTNQNALALGQWPFDQYFYIILNQSVGNGS
WAAPADISHTYETRFDWVRVYKKTDASTGIAAVEDDDRSFDVMVSPSQIRIAAPMRVAVS
ITDVSGRRVFAQQVQGNVSVRVQKGIYVVNGEKLIVP

Enzyme Prediction     

No EC number prediction in MGYG000003674_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	798	1041	3.5e-47	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	5.85e-57	797	1041	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	4.18e-21	793	1041	2	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	6.61e-21	786	1042	12	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	1.07e-20	799	1041	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	1.14e-16	865	1017	101	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	1.83e-169	7	782	10	778
QFQ13169.1	2.81e-101	505	1044	23	543
QUB63276.1	1.27e-71	776	1115	32	333
QUB65408.1	8.54e-71	776	1115	32	333
QUB87116.1	1.17e-70	792	1115	47	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	4.00e-31	790	1042	26	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ATG_A	8.88e-24	794	1048	4	245	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
6JH5_A	6.43e-22	868	1045	70	235	Structureof Marine bacterial laminarinase [Aquimarina]
2HYK_A	6.72e-22	795	1042	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4CRQ_A	6.96e-22	791	1043	1	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	3.12e-32	790	1042	53	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
C1IE32	9.75e-10	842	1017	65	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	2.04e-09	792	1048	24	257	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9Z3Q2	5.93e-06	857	1041	297	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000561	0.998419	0.000378	0.000218	0.000210	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003674_00384.