CAZyme Information: MGYG000003666_00325

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA6984
• CAZyme ID: MGYG000003666_00325
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43106.51	9.595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003666	1550881	MAG	Peru	South America

• Gene Location: Start: 2926; End: 4053 Strand: -

Full Sequence      

MKKIFIITGEYSGDMHASNVAKHLFEMNKDVQIEAIGGENLKKLGVKLFSDHSKMSAMGL
TPKIVWNHLTLGVKLINYLTKEYKPDLVLLIDYGVFNLKMAKHLKKAGIRTNYYIPPQVW
ASRKGRINKIKKYVDEVFCIFPFEKDMYESYGIKTTYCGHPLISQLPEKADKNNFFEKHG
FDVNKKLIAIFPGSRVFELKNLMETFLKSTNILKKMHPDLQFVFSQAPNLKDEVYKKYFK
NSDFKIIKGENQALLSVSDALILASGTVALEASLYNTPMIIAYKGPYLFYLIYLLVRCIK
RVSLPNIITDKDIVPEIIENSAKPDFIAYNIEKLIYDEEVRNKQIEGLKSVRELLSDKNS
SLEVAKRINEELSEM

Enzyme Prediction     

No EC number prediction in MGYG000003666_00325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1.9e-103	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.60e-115	1	355	1	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.91e-103	1	374	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.69e-74	4	355	1	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.60e-63	4	328	8	338	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.14e-47	1	370	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	5.67e-177	1	372	1	372
AKQ33376.1	3.56e-73	2	366	6	370
SNR14843.1	2.41e-71	3	373	2	369
VEH64871.1	8.04e-71	3	372	2	369
ADX67507.1	8.04e-71	3	372	2	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.12e-46	4	328	9	338	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.95e-45	4	328	9	338	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8JE78	2.35e-66	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	6.56e-66	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	1.30e-65	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B6J9H1	6.56e-64	2	369	4	371	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	1.30e-63	2	369	4	371	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003666_00325.