CAZyme Information: MGYG000003654_01426

Basic Information

• Species: F082 sp900542475
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900542475
• CAZyme ID: MGYG000003654_01426
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000003654_34|CGC1	51167.99	6.2404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003654	2069772	MAG	Peru	South America

• Gene Location: Start: 66918; End: 68315 Strand: -

Full Sequence      

MKRFLAFSILMISTLAVNAQNDTLFTRTELYHPGDYGSANYRIPAVITAKDGSVVAVTDK
RKYNEGDLPQDIDIVCNRSTDGGRTWSEPYTIAQGTGINHGFGDCALAWSNDENGLVAVF
VGGPGLWSSTPSNPIRSYKSYSYDNGQTWTEPEDITHFIFGDNCVIPEHQTWQASFFGSG
NGLLTSSGRIMFVAAIREGAAQSLNNYAVYSDDNGLTWQVSGRASTNGDEAKVTELVDGR
ILMSIRHSGKRRYNISEDGGKTWQPTTSTWNDITAPACNGDVIRYTSVSQGHNKNRLLHS
VPKGTQRKDVTVYVSYDEGLTWPVSKTIVPYNSAYSSLCVLPDGTIGLYVEEDPSGVSGY
STVFYNFSIEWLTNGDDTYGFDGISENNPDNALKIYPVLASSFIMIEADNIRKIRIFDAQ
GRLVKKKSVSTSSKVQINVADFPSGVYLVETKDVKGHKKHGRFVK

Enzyme Prediction     

No EC number prediction in MGYG000003654_01426.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	27	364	1.3e-76	0.9678362573099415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	7.02e-95	28	368	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.80e-19	71	348	17	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	7.14e-15	26	359	259	649	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam18962	Por_Secre_tail	8.04e-06	395	459	1	69	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	1.26e-04	395	465	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACM91104.1	1.88e-239	18	465	325	773
QCX54140.1	3.75e-135	18	386	170	535
QUT75110.1	9.46e-134	16	379	403	764
AHF12313.1	1.72e-127	22	384	268	636
SCM56345.1	8.62e-125	22	373	180	529

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	7.43e-43	22	372	6	359	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1W8N_A	2.59e-41	22	372	2	355	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1EUT_A	3.71e-41	22	372	6	359	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	1.26e-40	22	372	2	355	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	2.36e-40	22	372	2	355	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	3.03e-40	22	372	48	401	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	2.78e-34	32	351	194	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	2.80e-30	29	372	383	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P15698	2.54e-24	20	379	37	387	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P10481	1.42e-22	36	331	31	336	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000273	0.999019	0.000207	0.000163	0.000169	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003654_01426.