CAZyme Information: MGYG000003650_01988

Basic Information

• Species: UBA1786 sp900771425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA1786; UBA1786 sp900771425
• CAZyme ID: MGYG000003650_01988
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		94242.97	5.8396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003650	2572020	MAG	Fiji	Oceania

• Gene Location: Start: 10312; End: 12783 Strand: -

Full Sequence      

MKKILCIMVCAICTSVVQASDFITFKRHAATDVELTGKADTITYDPQDWKGVHIAVRNLR
QDLKAVTGSESAPIVVGTVGKSKWAKKYKQQSEQLEGKWEQYLIFTDNGKLVILGSDKRG
TIYGIYELSQQIGVSPWYWMADVPITKHDRLFAKSGCHTDGEPKVKYRGIFINDEWPSFG
TWCKNQFGGINSKAYARIFELMLRLKANYFWPAMWDSRFNEDDTLSPQMADDMGIVMGTS
HHEPMMRAHKEYVYRKDSIGEWDYSTNKANLDRFFEEGLERNKNFDNLITIGMRGDGDVA
MGKGNDEDNMKTLKDVVEGQREIIERVYKKPASEVPQLWAIFTEVQRYYDAGFTVPDDVT
LLFCDNNWGYIRRTGPEKERTRKGGMGMYYHIDMNGGPWNDRWVNATTAAKIREQLNLAY
QTGIDRIWIINVGDLKPKEMPIDFIMRYAWNPDAYPADKIDQYMVDWARSIFGGEYAHEI
ADIVTEYSKMNLERKPEVQRVGIYSVETGEAQRMYERWDELEKRALALSKKLPAEMQDAY
YQLVEYPAVGSAGVAKIYLAATMGDTLTMQTLFERDKQMTYKYNKEIAGGKWDGMMLDKH
IGYRQWSMPNDNTLPKANEPHDKDKVLAEPNEIAIMAHDYTRRTKTDDAQWTFLPGLGRG
KGDMGIEPVTAQSRPEGDGATLEYDVDFTKSGKQKLALGILPTNDINPGRGLRIGIRIDN
GEMQTIDARQGYVDTFNEYTKENIARSNILKPLPQPASDIYLSGFRQRMRSEVFDNLRWL
SIDLNIPSEGTHTLKVVMIDPEIVVEKLVINPDNEHPSYHGKE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	37	808	5e-233	0.9856527977044476

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	161	498	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.15e-34	633	821	9	169	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	2.53e-04	59	128	48	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC55419.1	0.0	33	821	46	987
QRQ50360.1	0.0	33	821	21	962
QDW23484.1	7.30e-294	42	821	56	981
QRQ59056.1	1.61e-289	22	822	5	975
ALJ47135.1	3.69e-289	22	822	30	1000

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	5.14e-183	42	819	55	843	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.78e-176	37	811	23	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.67e-173	37	811	22	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	5.43e-172	22	615	5	629	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	4.09e-116	18	628	1	656	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999090	0.000182	0.000140	0.000140	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003650_01988.