CAZyme Information: MGYG000003648_02890

Basic Information

• Species: NK4A136 sp002314855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; NK4A136; NK4A136 sp002314855
• CAZyme ID: MGYG000003648_02890
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000003648_457|CGC1	92585.86	5.9302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003648	3786163	MAG	Fiji	Oceania

• Gene Location: Start: 3275; End: 5725 Strand: -

Full Sequence      

MNKKIYNLMDWAGIEEIVYAEAVHPERLLGATNAGLSTLVQAFFPGAKSVSLRIDSKKGV
SKEKNEEIAMEMQDEAGYFAGLIKGKNRHDYSYVVTYDDKKKPVVCREVYDDYQVLSDDD
IDKILSGSCKDVCDKLGAHVTTINGVKGTAFSVWAPNAYRVSVVGDFNDWDGRIHQMIRD
DRSGIFTLFIPGVLSGNNYKYEILIKGGEKLHRIDPYSKKAEKGEGDASVVTDDISYKWT
DYKWIDARAGAHGRMNIYEICVSAYGEDATYKSITDKVLTHVKEYGYNYVEIMPIMYGHN
DLLGYKPSSLFALNESTGTYQDICYFVDTMHANGIGVIMELQCNSFEESESGIGYYDGTC
LYEHEDPRRGIDSLTGAKIYQYGNKMVDQMVISAGLYWVNKLHLDGIKMMDMAAMLYLDY
YRTEWIPNMYGDNENLEAINFIKRFNKSLHKLGTGVITIADDTLLWPYVSWTDDMSEADK
EKCLGFDYVINKGFNNDVISYMETDPIERAGKHNDLIVSTLYQYKEKYILSLSHSDVDFG
KGGLVTRMPGNWQDKYANLRAFYGYLMTHPGNKQVFMGQDEAWKESFDGVSSIGEALDES
SKQFANYVKALMNYCNKNKSLYELDYSDKGFEWINNHSANENVISFIRRDSEGNELLVVL
NFANVSYAKYKMGVPKKGKYKIAFTSDSKSYGGTGLMTTKTTATKEEKCDGFDNSVILKL
APLSFSVYTYEAYTEAELTEMERIKKEREAAILEAKRKREALAKEKARIKASLREELERK
IREAEAAIEAGSEFSKKETSPKKKSLKNTLKGIKKR

Enzyme Prediction     

No EC number prediction in MGYG000003648_02890.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	281	580	2.7e-88	0.9833887043189369
CBM48	135	221	1.8e-17	0.9078947368421053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	14	732	6	725	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	0.0	111	731	2	628	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	4.34e-153	114	730	4	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	8.29e-132	72	728	556	1220	glycogen branching enzyme; Provisional
PRK12568	PRK12568	1.35e-131	40	724	42	722	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97839.1	4.10e-193	1	730	1	732
QNM03882.1	4.79e-193	1	738	1	750
QBE99030.1	1.09e-190	1	730	1	732
QQQ92601.1	1.58e-189	1	781	1	790
ASU27851.1	1.58e-189	1	781	1	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	4.82e-124	134	724	7	603	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	5.58e-124	134	724	12	608	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
6KLF_A	8.68e-124	14	696	6	715	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.19e-123	14	696	30	739	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	1.19e-123	14	696	30	739	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1AZ86	1.66e-138	14	724	7	713	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q8DLB8	3.71e-135	14	696	8	716	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q2RR72	9.90e-135	107	724	98	726	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
Q7UVH1	1.24e-134	14	732	10	736	1,4-alpha-glucan branching enzyme GlgB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) OX=243090 GN=glgB PE=3 SV=1
Q608L5	1.16e-132	15	724	15	719	1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003648_02890.