CAZyme Information: MGYG000003638_00344

Basic Information

• Species: Prevotellamassilia sp004557035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp004557035
• CAZyme ID: MGYG000003638_00344
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46338.78	4.6964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003638	2109164	MAG	Fiji	Oceania

• Gene Location: Start: 3034; End: 4293 Strand: -

Full Sequence      

MKFADEGIEPFALTPSWAPVANADYYEVEFGGMVYSTIRDCAFTFDGLTAETAYTFKVRA
VNKDGYSDWTEAGAQTKSNPLEFAIKDIKATATCEDQGGQGINKLFDFDEKSSWHTKWGK
GEAVPFEATLDLRAVSQLDRLVYIPREDAGNGTLLKGTICYSSDRQHWSAPVAFEWARNG
EHKTFAFEGNPKARYVKMAVSEAVGNFGSGSEMYVFKVADTESFIQGDINRDKRIDENDL
TSYMNYTGLRRGDGDFDYISLGDINGNDLIDAYDISVVTTELDGGVRNSTDHVKGSLILT
PDKKTFAAGDVIAVKVSGKGLHYVNGLSFALPYQTDEFEYVGTELVGMKDMVNLTYDRLH
TNGQKALYPTFVNKGNNFLLDDGDNDLFVIKFKAKKAGKFSLKAKDGILVDRNLGTVSF

Enzyme Prediction     

No EC number prediction in MGYG000003638_00344.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08759	Type_III_cohesin_like	1.31e-12	295	387	1	95	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.
pfam00754	F5_F8_type_C	8.44e-10	89	198	1	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd14254	Dockerin_II	3.52e-07	227	280	1	51	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd00063	FN3	6.43e-07	16	71	20	87	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	8.75e-06	16	67	20	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13576.1	1.35e-188	1	419	849	1267
QKJ31076.1	1.25e-164	2	419	861	1278
QIL42693.1	2.06e-159	2	419	851	1268
ARS39208.1	5.13e-159	2	419	879	1296
QRO24224.1	1.05e-157	2	417	862	1276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A41_A	3.41e-17	87	216	29	160	CpGH89CBM32-5,from Clostridium perfringens, in complex with galactose [Clostridium perfringens],4A44_A CpGH89CBM32-5, from Clostridium perfringens, in complex with the Tn Antigen [Clostridium perfringens],4A45_A CpGH89CBM32-5, from Clostridium perfringens, in complex with GalNAc- beta-1,3-galactose [Clostridium perfringens],4AAX_A CpGH89CBM32-5, from Clostridium perfringens, in complex with N- acetylgalactosamine [Clostridium perfringens]
2V72_A	6.07e-10	81	217	7	143	Thestructure of the family 32 CBM from C. perfringens NanJ in complex with galactose [Clostridium perfringens]
7BLG_A	2.24e-09	72	216	12	160	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2J7M_A	3.21e-09	86	210	9	135	Characterizationof a Family 32 CBM [Clostridium perfringens]
2J1A_A	3.27e-09	86	210	10	136	Structureof CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose [Clostridium perfringens ATCC 13124],2J1E_A High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in complex with lacNAc [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	2.81e-07	86	210	627	753	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.81e-07	86	210	627	753	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003638_00344.