CAZyme Information: MGYG000003632_00512

Basic Information

• Species: Acinetobacter sp900771065
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter sp900771065
• CAZyme ID: MGYG000003632_00512
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41653.2	9.9461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003632	1897567	MAG	Fiji	Oceania

• Gene Location: Start: 2084; End: 3196 Strand: +

Full Sequence      

MHSSTSGQRPSLRPISKSSTFKMLALGSLLIPLYAISATKAPNQLDEVITQKKLTVVSVA
NPSTVFEEGQHRHGFGYDLVRHYADSLDVQLEFKTVPDNFTALKWVQSGQADFAMTTSHH
LSVEKRGLAAFSAACGDFSSLSKNGLNTDLNWVFKKADDPLSQNASAYVCRGKQNGSIQQ
LASFYNRNVVKEEAWDKIQTDLKNRMPIYKASFKRTAQQYDIDWHLLAAIGYQESYLKPN
SVSPTGVRGLMMLTNNTAKAMGVNNRTDPSQSIQGGAKYYNLMLDRYDHIPYPDRNWYAL
VAYNMGPNAVTNMQKQISAQGKDPNQWVNLYTYLDKTKTKNGRNRQALQYVTRIRTYLEH
IKTTPQLVSL

Enzyme Prediction     

No EC number prediction in MGYG000003632_00512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	362	1.4e-22	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	3.29e-67	39	357	30	446	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	7.99e-65	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	1.29e-50	103	361	169	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	1.16e-22	213	323	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	9.41e-20	226	310	3	85	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTD60189.1	1.28e-199	1	370	1	371
QTD63770.1	1.28e-199	1	370	1	371
QGM28144.1	1.28e-199	1	370	1	371
QTD61242.1	1.28e-199	1	370	1	371
QIV91948.1	3.67e-199	1	370	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	6.56e-43	37	366	75	428	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	7.48e-43	37	366	82	435	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	1.00e-42	37	367	68	422	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.00e-42	37	367	68	422	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	2.22e-42	37	367	116	470	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1U3J1	2.45e-46	19	359	6	446	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A4VP14	1.35e-45	103	367	187	459	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
Q02RN8	1.45e-43	37	367	107	460	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A6V102	5.47e-42	37	367	107	461	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	7.60e-42	37	367	107	461	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.572894	0.393031	0.031263	0.001332	0.000631	0.000849

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003632_00512.