CAZyme Information: MGYG000003631_01415

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000003631_01415
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		42831.38	7.9813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003631	1663259	MAG	Fiji	Oceania

• Gene Location: Start: 2069; End: 3265 Strand: -

Full Sequence      

MVWKAMLAAAACAAAMTARGADAPTAQKTSEPPAGPRTVLELPPGPGNPRNSEGDFARLK
NGDVLYVYSRYDKGHGDDADPASLASRVSRDGGRTWSAEDVEVVPNEGKLNVMSVSLLRM
GDGSLGLFYLRKNSGADCRPVMRRSRDEGRTWSAPQLCVPDSEIGFYVLNNSRVVRLSSG
RIVLPLCWHTPKGGDAFDGAGLLTCVVSDDDGATWRRAGAPFATTAADGRRVTTQEPGVV
ELKDGRALMFARTTEGRQWSWISADGCATWTDGGPWTLAGPCSPATVKRLSGGELVAVWN
DHETHPEYAKQGPAWARGARRPLTIALSRDEGRTWSPRRTVEDVPKGWYCYTALLELDGN
LLLGYCAEKMLCHSRVTLVPLAWLRGGGTPVNSPPPGP

Enzyme Prediction     

No EC number prediction in MGYG000003631_01415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	58	365	9.9e-42	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	7.11e-46	57	349	20	307	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.49e-30	77	351	13	267	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4447	COG4447	0.001	88	349	109	307	Uncharacterized protein related to plant photosystem II stability/assembly factor [General function prediction only].
COG4409	NanH	0.004	60	270	394	606	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU74856.1	1.39e-109	36	383	26	371
QDU41485.1	7.22e-109	38	389	319	665
QDU47982.1	1.07e-102	37	386	38	386
QDT24988.1	1.52e-102	37	386	38	386
QDT18502.1	1.89e-102	39	386	40	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBU_A	3.45e-11	56	384	99	427	ChainA, Exo-alpha-sialidase [Cutibacterium acnes],7LBV_A Chain A, Exo-alpha-sialidase [Cutibacterium acnes]
2YA4_A	5.98e-08	98	270	189	382	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	6.00e-08	98	270	192	385	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]
6QZH_A	7.47e-08	98	270	377	570	Structureof the human CC Chemokine Receptor 7 in complex with the intracellular allosteric antagonist Cmp2105 and the insertion protein Sialidase NanA [Homo sapiens]
2W20_A	9.76e-07	98	270	168	361	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62575	7.21e-06	98	270	488	681	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	7.21e-06	98	270	488	681	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002845	0.919870	0.075987	0.000620	0.000343	0.000302

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003631_01415.