CAZyme Information: MGYG000003631_01189

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000003631_01189
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		38140.22	6.6139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003631	1663259	MAG	Fiji	Oceania

• Gene Location: Start: 16; End: 1068 Strand: +

Full Sequence      

MGDTHPETSSILAVFGAASILPESLDYAAAITPPATHVMNGMPNYTLWWVRNLHDWYFHT
GDLAYLRRHADYLRTVMPRIAKAVKADGTQTWGGFLDWPSQHNHAAQISGTCGLVATTLE
NAAFLAHELKDAETERVCTEALARIRRGKPEFAGSKQAAALLALSGLRDPKEAYAEVLGR
DGLKGVSTFYGYYMLEAMSAAGENQHALDTVRDYWGAMLDVGATSFWEDFNVAWTNNCFR
LDEMPVPGKKDVHGDYGEFCYPGYRHSLCHGWSSGPAAWLIHHVLGARITGVGGAEVTVN
PFLGTLDWAEGALATPKGPVKIRVEKGADGKLKTKIDAPAGVRIVEGVRP

Enzyme Prediction     

No EC number prediction in MGYG000003631_01189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	1	343	2.5e-54	0.6924603174603174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.33e-04	31	284	85	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.003	286	343	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL50446.1	8.12e-112	1	346	235	580
QGQ98689.1	3.56e-111	1	345	213	557
QTN30984.1	1.28e-108	1	346	237	583
AWI10121.1	5.04e-108	1	345	249	594
QTF59433.1	7.63e-108	1	346	240	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.34e-21	34	322	374	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000030	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003631_01189.