CAZyme Information: MGYG000003631_00618

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000003631_00618
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915	MGYG000003631_206|CGC1	100469.35	8.0188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003631	1663259	MAG	Fiji	Oceania

• Gene Location: Start: 154; End: 2901 Strand: -

Full Sequence      

MKTMTGAAFALSALCLSAVWADETYGLKTCRLEKPYNIEKPVFSWKMRSDRQGAAQTAYR
LAVSCAKTGKEIWASGEVAGGVSTGVKYAGPSLKSGCRYGWSGQGKNEKGEWLAPAKSAF
ETALLEKDGWAKAKFISVDGKPEGGADTASFLKTIVNAKDVAQVYWFTTGLGVYDAYANG
ANITHLEEKGEDKEFLKPGFTHFAKRRHAFGYDITHQVKTKAGERNVYAAWVTEGWWSDQ
PNGRRGKESAFAGVMIYRYADGTEERFATDGSWLGAYGKSAVTHAGIFEGQDEDARIDLG
WMKSGDAAGFKPVKFNNEFKGDIVPMQGSPARLRFDLVTQPVAAYAYRDVEGAAADRFGK
VKKLRDYTDFKGIKLAKGETLIVDFGQNMAGKPNFSLTAGAGTKVKVNFAEMLNDGMGQK
SRKCDGPEGSLYRKNYRAARSELNLVCSGRKADCFHTKYSFFGFRYIGVTATDDLVIDEV
CAVPISSVLANMETGRLSTSDASLNRLISNGFWGMYSNYLSVPTDCPQRDERLGWSADTQ
VFTKTACFNADVYGFLSKWMTDMRDSQHGDGGFPGVAPVAQYGNNGAALGWADAGIIVPH
TLWRMFGDASVLEENWDAMEKYLGYVMKHHGPNPEPWGEWLAYERNDRAIKEYLAAAFGV
WDAMMMQDMAKALGKADAAAKYAAFEKEQRAFFATNFLDAAGAIREKFSGQAACVYAIFL
DLVKGDAYKKTVEDLVANITRHGGKLQTGFLGTAVIQQALVKAGRADVAYTLLLQRGNPS
WLYSIDQGATTFWERWNSYTKESGFGDAGMNSFNHYAYGAVIAWMYDSMAGIHEDKAAPG
FRHFVLAPHPDRRVNAVTAEYDSAYGLVKSAWKYDGDKWTWNFTVPANTTATVVCPCGTT
KEYAAGSYTLGAQLK

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	376	894	5e-153	0.9880952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.65e-105	493	826	2	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.73e-26	159	334	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.56e-20	373	486	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.39e-18	831	907	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT79109.1	3.98e-234	122	908	35	852
CBK67329.1	3.98e-234	122	908	35	852
QDM10529.1	1.12e-233	122	908	35	852
QUT31728.1	2.25e-233	122	908	35	852
QUR45392.1	8.69e-233	122	908	34	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	8.99e-111	125	896	273	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	8.55e-74	25	896	33	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	3.47e-72	40	896	22	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.48e-110	40	915	54	900	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.86e-110	125	896	273	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.16e-97	36	896	46	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.55e-66	39	894	49	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.999086	0.000165	0.000159	0.000142	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003631_00618.