CAZyme Information: MGYG000003625_00091

Basic Information

• Species: UBA2913 sp900770895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; UBA2913; UBA2913 sp900770895
• CAZyme ID: MGYG000003625_00091
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000003625_10|CGC2	40198.7	8.4375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003625	2467170	MAG	Fiji	Oceania

• Gene Location: Start: 24330; End: 25424 Strand: -

Full Sequence      

MSFHHKRSSVQAPAAGARILVIRLSAIGDVLHATTVVHRLRELRPDLDITWLVSPPADVL
LRYNPDIDHLLVWDRRPIDRASASHDWRTVARELRAARQLLRRQQFDIVLDIQGLFLTGL
LARFTGAPRRIGIHERHEGNPLFMTEMAPDIASPHKVKRYFTALAPLGIGPEAFKPCPVL
CLPPELDSFAAGFWAERGIRCGDADRPLLLVCLRTTWPDKHWPPQKFAAALAPLPENIQI
VFTGSQGDTPYIEQARAAIARPTSSIAGTTGLLELAALMKSADLLLTCDTGPLYMAEAVG
LPTLSLWGPTSPSIYGPLSPGHHFIESPAACRSCCRTRCRRHTNECINAIDPVIVTSKLK
ELLC

Enzyme Prediction     

No EC number prediction in MGYG000003625_00091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	97	343	5.7e-52	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.31e-56	18	352	1	268	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.65e-55	18	364	3	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.18e-34	95	320	2	222	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02193	heptsyl_trn_I	3.68e-31	18	324	1	297	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02195	heptsyl_trn_II	5.10e-20	18	319	1	289	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL82085.1	6.66e-147	16	363	6	350
AEC01127.1	2.31e-121	17	363	6	351
QJW47207.1	1.37e-74	18	363	6	346
AIF50492.1	6.44e-68	19	362	5	342
BBB92122.1	5.36e-67	18	363	6	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.34e-18	18	317	10	297	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	7.76e-09	18	328	2	300	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	7.76e-09	18	328	2	300	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	8.04e-09	18	328	2	300	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.18e-21	19	312	11	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37421	3.05e-12	18	319	2	299	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	4.31e-11	18	319	2	299	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P25742	7.59e-11	28	317	5	286	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	7.72e-10	28	359	5	330	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003625_00091.