CAZyme Information: MGYG000003620_01723

Basic Information

• Species: Bulleidia massiliensis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia; Bulleidia massiliensis_B
• CAZyme ID: MGYG000003620_01723
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000003620_159|CGC1	36217.89	5.0892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003620	2688357	MAG	Fiji	Oceania

• Gene Location: Start: 8985; End: 9941 Strand: +

Full Sequence      

MHCYYIILGAQTADHHGCALIYRSEDLLHGWVFAGQLNVPGFENFGDMWECPTIEKIGGK
EILMFCPQHLSIPGRGNSKNHNGYIIGSMDWNSLTFQPVTQFHVLDFGFDSYAAACANNV
SDPDKAILVAWMGLPDSSYPTDEEDWQGCLTLPRELRIRGRRLVQQPLPQLKELRDLELD
VTNAENGAVCNLPRVCEMEFYCRPGDYHLRLFSRADGEGGLRLDYNQKTGNITIDRSGME
VRFNEEQGESRTRNLNNGLTHLRIFIDRSSIEIFVNDGDAVFTSRVFPKGEETHFQVAGD
TFLRMWTLKRAIRDDFVI

Enzyme Prediction     

No EC number prediction in MGYG000003620_01723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	4	167	2.9e-39	0.5187713310580204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	7.58e-87	2	289	157	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	7.73e-69	4	309	175	485	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	8.27e-62	4	160	136	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.36e-57	4	278	147	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.41e-47	3	167	143	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH26411.1	8.20e-116	4	316	178	482
AND78672.1	1.80e-115	4	318	178	487
AHF26479.1	4.40e-113	4	318	178	485
VEI59413.1	1.46e-111	4	318	178	486
QEY06991.1	1.46e-111	4	318	178	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	6.74e-39	4	308	177	485	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	6.24e-36	4	291	191	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	6.24e-36	4	291	191	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7VCO_A	2.03e-32	4	309	172	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	6.16e-20	6	289	150	407	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05936	2.44e-49	4	304	179	483	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P07819	5.92e-44	4	288	172	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q04937	1.52e-38	5	310	179	473	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
P43471	1.63e-38	2	301	176	475	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	1.19e-37	4	293	177	461	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999890	0.000142	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003620_01723.