CAZyme Information: MGYG000003613_01323

Basic Information

• Species: SFDP01 sp004558185
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; SFDP01; SFDP01 sp004558185
• CAZyme ID: MGYG000003613_01323
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000003613_101|CGC1	46266.06	6.4529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003613	2865067	MAG	Fiji	Oceania

• Gene Location: Start: 491; End: 1705 Strand: -

Full Sequence      

MKEKMKEKVNLGVIGLGARGEGLLKLVYMQHPEVEFVAVCDHYQDRCEAAAKLLTDHGRQ
MPMKTTDYREVLKKQEIDAVILCTSWDQHIHLCIEAMEAGKYVGCEVGGAYSVRECWKLV
EAYERTKVPVMMLENCLYGRDEMMIRHMAETGVLGKIIHCEGGYHHDLREEIAFGKENRH
YRLSNYLHRNTENYPTHELGPIAKILGINRGNRMMTLTSVASAAKGLEEYIKVRKPQDSA
LKGVRFCQGDIVNTMITCAGGETILLTLDTTLPRYYSRGLTVQGTKGMYCEENRSLYLEG
GEHEKDHFDWKKHWGNVEEYRNQYEHPVWKAYLEEGVKQGHDGMDWLVFCDFVEFVKKRK
EATADVYDMAAWMSITALAEESIALGGQPMAIPDFTNGAWMERR

Enzyme Prediction     

No EC number prediction in MGYG000003613_01323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	6	402	1.1e-143	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.16e-22	8	394	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.01e-11	9	132	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	5.23e-05	10	103	2	87	Predicted dinucleotide-utilizing enzyme [General function prediction only].
COG0460	ThrA	1.28e-04	6	103	1	109	Homoserine dehydrogenase [Amino acid transport and metabolism].
PRK10206	PRK10206	5.72e-04	65	167	53	153	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41319.1	8.86e-189	5	404	4	401
ALS29040.1	4.75e-188	5	403	1	398
QJD87109.1	1.52e-185	5	401	1	395
QTH43530.1	1.83e-184	5	404	1	399
QNK55026.1	3.56e-184	5	404	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	8.66e-92	7	404	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.63e-62	8	400	42	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	1.43e-11	12	165	27	177	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E18_A	6.15e-11	7	165	4	154	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
4HAD_A	1.87e-07	61	164	71	174	Crystalstructure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	4.74e-91	7	404	19	435	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.57e-88	8	404	33	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	2.92e-82	8	404	49	461	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	1.71e-81	9	404	53	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q0HKG4	3.57e-78	7	400	53	448	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003613_01323.