CAZyme Information: MGYG000003611_00266

Basic Information

• Species: HGM04792 sp900770705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04792; HGM04792 sp900770705
• CAZyme ID: MGYG000003611_00266
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		84261.31	5.5662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003611	1994731	MAG	Fiji	Oceania

• Gene Location: Start: 11075; End: 13315 Strand: +

Full Sequence      

MKKSYLLAALLCGTLLPTKAQVHFVNPVPQQVETSDEAKSLFAAPQAWQLVTDAARQNGP
AALAFKNSGQNIEAQAKYRLLLGLKGDKTVKSVAKQVPEHEEGYYLRITDKEAVIAGYDE
QGLFYGVQTLLSILRDGKLQKCEITDYPDVKYRGVVEGFYGRPWSHEDRLRQFDFYARNK
MNVYIYGPKDDPYHREHWRTPYPAEEARRIQILAEHAKTCGVNFYWAIHPGLDIKWTDAD
RDALVAKLEQLYGLGVRSFAVFFDDIWGDGAKADKQADLLNYVDNNFVQKKHDVAPLVLC
PTEYNRAWANDEGGYLRTLGDNLNKSIEIMWTGNSVVHCIDKESMEWINSRIARKAYIWW
NFPVNDFVRDHILLGPTYGNGLDIAGDLSGFVSNPMQYAESSKVALYSIADYTWNMESYD
WEASWNRALEDLLPGQAEALKIVASFNEDLGPNGHGFRREESRRLVPIAKAAAEGDQNAI
LQLGLQCKQLSIAADILLGAKENPWLIEELRPWLLQMKNVAAYGDNICWMGNSVDKDPNK
ISPALPLMRFEMLYAQAKSQQKQIYDFEANPANLHEYQTGAKTATRVLLPALQQIFTQAV
ETYNSRTGAHLDPTAEYMPYALTSTVPQLAQQPITGRGSDVQVERSLEVVTWPADSYLEI
KMDRTITLQGLDFDFGTPDTAGDFKLEILRPDGTWTEVGLLHYNAGETVVHTGNELGGMD
ANAIRLTNKSGKELQRYFKSFRFSKR

Enzyme Prediction     

No EC number prediction in MGYG000003611_00266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	153	443	2.7e-110	0.9898305084745763

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.14e-169	153	441	1	291	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam18344	CBM32	5.96e-20	611	674	1	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
pfam02838	Glyco_hydro_20b	2.61e-11	27	146	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	3.21e-07	93	204	196	311	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23617.1	2.67e-243	1	743	1	736
AVM51628.1	9.27e-230	1	742	1	731
QMI79077.1	4.68e-227	2	744	3	732
QUT34074.1	4.68e-227	2	744	3	732
AVM57269.1	3.90e-226	1	743	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	1.15e-213	3	741	5	730	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	6.54e-213	3	741	5	730	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	6.54e-213	3	741	5	730	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	7.20e-212	25	741	4	708	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	7.45e-212	25	741	5	709	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	6.32e-213	3	741	5	730	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	9.47e-91	101	445	130	480	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	2.51e-90	101	445	130	480	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	1.86e-43	95	514	118	577	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q2CEE3	1.40e-42	154	412	4	272	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998885	0.000249	0.000185	0.000164	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003611_00266.