CAZyme Information: MGYG000003610_01085

Basic Information

• Species: HGM04593 sp900770665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770665
• CAZyme ID: MGYG000003610_01085
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
963	MGYG000003610_58|CGC1	107606.76	4.556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003610	2461139	MAG	Fiji	Oceania

• Gene Location: Start: 8443; End: 11334 Strand: -

Full Sequence      

MKKLFLGISALIFTAISFNANAQTAKIYPIPQSLVWGNETAFENSASYTITGEADADADA
VNLFKKNFSTTDGAVELIIGERGDAAVATYESLIPQKAEGYYLTVEKDKVIIAGNDGSGT
YYGVQTFTQMASQPNVMCATVTDYPSVPQRGLVEGYYGNPYSEADRMGLLEMFGEMKMNV
YIYGPKDDAYHKSKWREEYPADLAKKITEYVNVAKANKIEFMWAIHPGEDIQWNATDRAN
IVNKLKAMCKLGVRSFAVFWDDLWGDDGTHGDEQAELMNYIAAELRKEYPDVKPLTICPT
QYNRGWANTIYLPALGDIMDSDINIMWTGNSVVDMINKGDMEWINNQIKRKAYIWLNYPV
SDYCINHLLMGPTYGNDLNIADMLSGFVSNPMEYAEASKVSLFSIADYTWNMPAYDSNAS
WEAAMKYLMPENYEAFRFFCENNVDLGANTHGLRRMDESPEFIKAKEVYNNKIATDREAA
YAAVSEQFQKLVSAAETLLTTDEAPALTKEIEPWIQSMKYLGQRGVCIIEMNNALAEKDS
EKFIDNYLKYKEYDEAQAALRSRDFAGSLKTATPVVGTVHIEPFIKEVAGTLVAEYKESY
DYRTDVFPAQALENGTYYIMYNGKYLTNNNKAAGSKPSFLAEQDNIRPQRQEWKISIDPS
TNRYKIVNLEDNRYLNENGSFTVSDATNPYEAVWHTYDITLLANGKYAIQNGGSAGTAFW
TVSGTQIQKGNTTALPDKYIFDIIPLGGKANEPFIDQNETYYIIDGNRYLTNSNVGGNGG
TPTFKEIEEPAATQEWKIVPDANGSNCYKITSGADGRYVNELGVFGTNQYYADWNTYLIT
KMGDMWSMQLTQSATKNGVKYIVVSGDRLEAKGVARNESYTVKIVRKGDDTSIENTASVD
FEITGDNIVCNTDVKSITLFAADGREVKCARGNILGVKDVANGVYVVVAKSDSDTRTYKV
SLK

Enzyme Prediction     

No EC number prediction in MGYG000003610_01085.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	150	440	3.3e-99	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.26e-142	150	439	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.09e-15	27	143	4	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	3.00e-272	1	748	1	737
QUB43766.1	1.99e-177	77	745	71	736
AFL96774.1	6.37e-156	94	601	82	591
AIP99456.1	6.37e-156	94	601	82	591
ATA90410.1	3.17e-154	75	637	68	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	4.09e-143	22	614	21	619	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	6.72e-143	22	614	3	601	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J47_A	8.65e-143	23	614	1	598	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2CHO_A	8.65e-143	23	614	1	598	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	2.23e-142	22	614	21	619	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	2.24e-142	22	614	21	619	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	9.46e-87	26	543	45	583	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	6.36e-86	26	543	45	583	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	1.36e-47	91	592	124	651	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	9.16e-31	151	418	63	335	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999100	0.000179	0.000173	0.000160	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003610_01085.