CAZyme Information: MGYG000003605.1_00966

Basic Information

• Species: Alistipes sp900770635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900770635
• CAZyme ID: MGYG000003605.1_00966
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43472.46	5.2827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003605.1	2259375	MAG	Fiji	Oceania

• Gene Location: Start: 111584; End: 112738 Strand: -

Full Sequence      

MTFLRTLFMLAAMLVGINTLSAQQNLWQKQGLTSPEILADNSVVVRLYAPQAASVVLKCD
FVDGGQVAMTRTDDGVWEYHSEPLASELYCYRFSIDGMADIVDPSSSYVMRDVGTLMSYF
IIAGERGALYSPQAVAHGTLSRVWAKVSDGRERRMTVYTPAGYEQSKRKYPVLYLLHGMG
GDEEAWVATGRVQEIMDNLIAEGKAEPMIVVMTNGCTKHVAAPGHSEEGMWRPYMSGSMD
GTFEKMFPSVVEWVDEHYRTVAKRESRAIAGLSMGGFHAMQISKEYPSMFDYVGLFSAAI
FRGQEGVATYENLEPKLERQFAEQPVLYWIAIGSNDFLYDENVEYRSLLDKHGYNYIYRE
SSGGHEWRNWRIYLSEFAQMLFKK

Enzyme Prediction     

No EC number prediction in MGYG000003605.1_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	150	379	2.3e-55	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.88e-33	101	384	28	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	4.20e-25	41	122	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	6.09e-22	150	381	5	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.02e-13	132	371	11	298	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	1.01e-12	150	336	20	204	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42548.1	3.72e-137	22	383	19	397
ADY36651.1	2.13e-136	5	383	3	397
ALJ59664.1	1.07e-135	12	383	10	393
QKH98968.1	9.89e-135	5	383	3	397
QUT21362.1	9.89e-135	5	383	3	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	6.06e-98	32	383	22	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.59e-57	31	383	36	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	5.46e-45	31	383	13	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	5.59e-45	31	383	13	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	1.30e-44	31	383	38	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	7.85e-40	35	384	329	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.26e-33	36	383	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	5.58e-30	25	383	385	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	3.67e-26	153	380	65	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P23553	1.13e-10	173	383	44	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999144	0.000171	0.000146	0.000135	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003605.1_00966.