CAZyme Information: MGYG000003605.1_00136

Basic Information

• Species: Alistipes sp900770635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900770635
• CAZyme ID: MGYG000003605.1_00136
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000003605.1_22|CGC1	54530.76	4.7241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003605.1	2259375	MAG	Fiji	Oceania

• Gene Location: Start: 60616; End: 62073 Strand: -

Full Sequence      

MRKTSFTIGAVIVAVAMMITGCNKRDNLFEASVGYSIEDGIITLDEPERSAEQQSMIEFR
CEPIDTVRVGFVGLGMRGPGAVERFTYIDGVAINGLCDKYPERAERCQAYLDRAGMPHAK
VYSGDEGYKQLCESDDIDLVYIATPWQLHVEVAVYAMNHGKHVAIEVPSANTVAECWQLV
DAAERNRVHCTILENCCYDHFELTTLNMAQKGLFGEIIHAEGAYIHNLEPYWEHYADNWR
LEFNQAHNGDIYATHGIGPNCQALNIHRGDMLDYLVAMSTKSINGSKLTKELMGEEECKQ
GDQINTLIRTVNGCTIDMQHNVMTPRPYSRMYQLVGTEGYANKYPVQGYTFKLDQIKSVA
KDENGMPDIEALDHHSFAPADVAIEMTKLYRHPVQLQLVDGVPLQEYSLSIGGHGGMDFM
MDYRLVYCLRNGLPLDMDVYDAAEWSSMGELTRISIENGSKPVKVPDFTRGDWNKVDGLT
FYFAE

Enzyme Prediction     

No EC number prediction in MGYG000003605.1_00136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	475	1.8e-150	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.56e-22	66	259	3	186	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.89e-17	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	4.15e-05	114	245	28	161	putative oxidoreductase; Provisional
COG4091	COG4091	7.08e-04	67	163	18	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01207.1	1.11e-208	1	485	1	466
BBL11909.1	1.57e-208	1	485	1	466
BBL09117.1	1.57e-208	1	485	1	466
AFL77663.1	3.06e-208	1	485	1	465
BBL06379.1	4.24e-206	34	478	25	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.34e-74	59	473	35	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	2.15e-66	67	473	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	2.72e-13	72	339	11	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EC7_A	4.90e-11	66	186	23	137	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
1EVJ_A	1.51e-10	104	251	38	182	ChainA, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZX8	6.22e-190	42	485	32	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	5.83e-189	47	485	41	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q5LGZ0	3.48e-186	47	485	34	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	3.48e-186	47	485	34	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	1.33e-179	42	485	33	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000065	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003605.1_00136.