CAZyme Information: MGYG000003603_01266

Basic Information

• Species: UBA3388 sp002358835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp002358835
• CAZyme ID: MGYG000003603_01266
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		30804.38	7.7845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003603	1899995	MAG	Fiji	Oceania

• Gene Location: Start: 4287; End: 5087 Strand: -

Full Sequence      

MKFIYYTFISLFAVCISLNSQAQNSNQYKDPTTLEYIERYKHIALEHETTHKIPACITLA
QGILESGSGTSRLAKEANNHFGIKCHSNWQGNTFHKDDDKKNECFRAYDTPEESFEDHAL
FLKKKRYADLFDLDIRDYEGWAKGLKQAGYATNPKYPQLLIDLIEKYSLQDLDNMEYEKT
EPAIAQNEAINQTNSFAVSAPSNQVSENQNEVSEEQNEVSVYQYERKRHSLSSYWAKKAA
LRKADKDSKSRIQPSNKRRTLFGKRK

Enzyme Prediction     

No EC number prediction in MGYG000003603_01266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	43	169	2.5e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.82e-35	9	174	19	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.25e-27	31	169	158	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	5.99e-26	41	118	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.60e-21	33	170	8	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12709	flgJ	1.69e-17	53	166	193	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK52630.1	3.27e-63	16	179	36	201
QEM06890.1	1.23e-62	19	178	35	199
QTE43972.1	1.23e-62	19	178	35	199
QTE64880.1	1.23e-62	19	178	35	199
QTE50573.1	1.23e-62	19	178	35	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.31e-09	53	170	21	149	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.53e-09	53	170	22	150	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.01e-08	53	170	22	150	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.36e-07	16	174	43	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.66e-07	53	166	23	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.12e-15	42	184	58	204	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.56e-07	57	166	184	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	1.14e-06	53	166	169	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	1.14e-06	53	166	169	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q2G222	1.70e-06	16	174	303	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000648	0.948905	0.049715	0.000268	0.000225	0.000217

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003603_01266.