CAZyme Information: MGYG000003591_00008

Basic Information

• Species: CAG-177 sp900770255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp900770255
• CAZyme ID: MGYG000003591_00008
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000003591_1|CGC1	35805.62	7.6096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003591	1880790	MAG	Fiji	Oceania

• Gene Location: Start: 6298; End: 7257 Strand: +

Full Sequence      

MIIKKTKELIFTEKPTDSCHASTVLPLSGGRVVAAWFAGTAEGADDVDILTCVRTADGWG
VPVRVSADPATPHWNPVLFELNDGRIILFFKVGKKIPMWKTYFCTSEDGVRWSEPRELVP
GDISGGRGPVKNKPIRLKSGRVVAPASDERNTLWVCFADISDDDCKTWNRRPTVPTKSAK
SFYVPMIQPTLWQSDDGAVHMLTRTQRGRIYRSDSYDEGESWCRAYRTALPNNNSGIDLV
RAQNGKIYLVYNPVGKNWGTRSPLDLAVSEDGGESFKQLLRLESGEGEFSYPAITELDGS
LHITYTYKREYIAYWKIEI

Enzyme Prediction     

No EC number prediction in MGYG000003591_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	13	308	2.1e-29	0.9152046783625731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.08e-84	30	303	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	2.26e-55	15	314	29	368	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	1.51e-49	8	310	1	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd18607	GH130	4.03e-04	244	306	15	83	Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95056.1	1.42e-107	7	317	8	331
QTV77693.1	2.06e-105	7	313	3	326
AFH63259.1	1.94e-104	7	319	12	330
ACX65278.1	2.17e-102	5	317	6	323
AFC30937.1	2.37e-100	2	319	7	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999986	0.000052	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003591_00008.