CAZyme Information: MGYG000003578_03350

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS2037
• CAZyme ID: MGYG000003578_03350
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48037.27	7.8303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003578	3478423	MAG	Fiji	Oceania

• Gene Location: Start: 4452; End: 5723 Strand: -

Full Sequence      

MNFNIITIGSRGDVQPFIALCKALQKRGHETRITTFLNFKDFIEGEEIEFFPLAGDAVEV
IRLLIGENVTTSEYFRNLEVLLNPVKEQFFDDIEQSCKNMDAVIYSTLGSVVYHVAEKYN
LPVFRVAFCPLDPTWEFPAMTAPYIPGFRAYNRFTFWMGDRLWSHATRKLCNDWRQELGL
KRVPVGRFPYRKLHGKEIPTLYAYSSLIAPKPKEYKEYHHLTGFWIKELEENYVPEKSLQ
EFLERGEKPIYIGVGSMVGKEFQNLFDIVMESLRITGKRAILSSGWGNLEGVDVPDTVYQ
IKSVPHEWLFTKVAAVIHHGGAGTTAAGIRAGVPTVIVPFGGDQPYWGRQVHRMNIGTKP
ILRKSLTVRNLSAAIMEVTTNQEMIAQAKIIGQKLREENGAEYAVAVIEKELHEAASGRS
ARN

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	6	411	3.5e-52	0.9895287958115183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.63e-65	1	410	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	7.59e-60	1	419	2	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	6.98e-29	6	414	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	2.99e-09	5	56	3	56	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
PHA03392	egt	1.52e-05	220	381	274	432	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT62528.1	1.28e-179	1	409	1	409
QAT48736.1	1.94e-120	1	409	65	470
CAB1252917.1	1.75e-108	1	364	1	362
BAY41773.1	1.27e-101	1	412	1	419
AFZ29125.1	1.62e-98	1	413	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.58e-68	3	417	22	444	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.56e-68	3	417	42	464	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	5.94e-33	1	380	1	351	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.55e-32	9	395	9	384	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
1IIR_A	7.79e-30	1	401	1	388	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7ERM5	3.77e-79	1	417	940	1362	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
A1CYS1	1.32e-76	1	415	911	1331	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
Q4WID6	3.27e-76	1	415	902	1322	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
Q0CKU4	4.39e-76	1	415	898	1318	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
A1CFB3	8.28e-76	1	415	908	1328	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003578_03350.