CAZyme Information: MGYG000003574_00998

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_00998
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000003574_195|CGC1	48547.1	5.457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 27695; End: 28984 Strand: +

Full Sequence      

MTFPNNFYIGAATAAHQVEGNNVHNDCWALEQMPNSAYAEPSLDAVDHYNRYEEDIKLMA
SAGLNAYRFSIEWARIEPQEGVFDEKELEHYRDVIRCCRANGIEPIVTLHHFSSPKWLIS
KGGWEADTTVDDFAKYVRYLVEHLGSELNYVCTINEANMGVQVAAIAKRYMQQMMAKMGA
AKMDGTVQVGMNLEKLMASRQAAAAKANMEVFGVAKVESFTSPRTAHGDEIIMEAHKAAR
AVIRELAHHVKVGLSLSLHDIQPIPGGEERAAKDWEEEFVHYLPVIAEDDYLGIQNYTRS
RIDANGIMPCPECAELTQMEYEFYPEALEHVIRRVHKDFKKELIVTENGIATADDSRRVE
FIRRALAGVSSCVANGIPVRGYCYWSLMDNFEWQKGYSMTFGLIAVDRKTQTRYPKESLA
YLGRMCSEQ

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	427	2.5e-116	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.32e-88	1	418	2	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	4.23e-88	4	418	1	422	beta-galactosidase.
pfam00232	Glyco_hydro_1	1.55e-74	2	418	4	440	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.03e-58	2	421	4	457	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	2.12e-35	3	421	28	475	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK81646.1	1.06e-215	3	426	4	427
AEN97245.1	1.14e-214	1	423	1	430
AHF25575.1	5.35e-204	3	425	11	425
QTE67958.1	9.42e-204	1	424	1	424
AHF26359.1	4.14e-201	3	425	11	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.45e-117	3	429	7	412	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	1.66e-96	1	425	30	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.65e-68	1	418	9	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	6.89e-64	1	425	3	402	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6YN7_A	1.36e-50	1	429	6	442	ChainA, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_B Chain B, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_C Chain C, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_D Chain D, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12614	4.43e-50	3	427	11	447	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
Q03506	7.76e-46	3	418	6	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P10482	1.19e-45	1	428	3	453	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	3.60e-45	3	418	4	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	7.25e-45	3	418	6	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_00998.