CAZyme Information: MGYG000003574_00168

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_00168
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		34754.75	4.5057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 279; End: 1178 Strand: -

Full Sequence      

MHYKLSNPNADVTTQEVYRFLCSLSGDHTLSAQQESTWMGSADYEMDYILKVTGKLPAMR
GLDYMHDDFDGVNQRAVNWWKQGGLVTICWHTGADFCGEWKDCMEDSISDWDAVLTEGTP
EHDTFVAGMDKAARALLELQEQGVTVLWRPFHEFDGKWFWWGKGGAESFVRLWRLMYTRF
TEHWGLHNLIWVLGYSHLYEGYQGWYPGDDYVDIIGSDSYQGGAQNRLYQSLTKITRTKP
YAFHECGTNPTAEELTTTPWAWFMTWHTLYIMDENSPENLSSLYNSEYVITLDEMPQFH

Enzyme Prediction     

No EC number prediction in MGYG000003574_00168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	6	294	1.2e-87	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.64e-43	7	294	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	9.99e-17	142	247	178	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	5.24e-107	5	299	167	463
BCN30282.1	2.05e-106	4	298	5	299
AJP70762.1	8.19e-73	5	295	22	318
AWB26443.1	3.35e-69	5	296	48	337
QQQ74226.1	7.23e-69	7	296	175	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	1.02e-51	7	295	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	9.17e-47	4	267	44	315	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	1.34e-46	8	296	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	1.54e-45	5	295	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.63e-38	29	295	31	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	8.16e-45	4	298	145	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	9.79e-44	5	295	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	5.15e-36	5	299	156	463	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	7.22e-36	5	299	158	465	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P16699	1.47e-35	5	247	34	297	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_00168.