CAZyme Information: MGYG000003570_00781

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_00781
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000003570_67|CGC2	40722.43	8.2587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 31103; End: 32167 Strand: +

Full Sequence      

MKNRKVYRLFFFCAVLTGLFFSCSDNEKYKNDTHKAVLDGKTVVERYGHLQVNGTDLCSQ
DGQPVQLHGMSSHGLQWYGKYANKDVIKWLRDDWNCQLWRPALYTQGAYIGNPVLKQKVI
DSIEACIDCGMYVLVDWHVLADKDPLLYADYAAEFFDEISKKYGDRPNIIYEICNEPNGK
DVTWKENIKPYAERIIEVIRKNDPDNIIVIGTPNWSGDVLSAANDPVLNQKNVMYTIHFY
AGSHKSERRKQVKSALKKGIPVFATEWGCTKESGDGGVFEKETLEWIEFMKKNNISWVNW
SVNNKGEDSGILVYNADREAKGNWKDKDLSKAGKFIRKIMRGELDLKTYKPEKK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	299	3.9e-93	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.61e-72	58	306	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.77e-14	61	327	58	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJT73064.1	1.28e-159	22	345	19	339
AEJ20552.1	1.04e-154	31	344	24	339
QSI02355.1	8.49e-149	4	344	2	340
ABW39350.1	1.02e-146	1	347	5	348
AAA22299.1	1.33e-114	39	341	27	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	2.88e-122	40	341	3	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1LF1_A	5.62e-116	39	341	1	301	CrystalStructure of Cel5 from Alkalophilic Bacillus sp. [Bacillus subtilis]
1H11_A	1.92e-115	39	341	1	301	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1E5J_A	2.05e-115	39	341	1	301	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]
1H5V_A	3.98e-115	39	341	1	301	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06565	2.66e-115	39	341	27	327	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
O85465	2.61e-113	39	341	27	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P07983	4.00e-112	41	352	33	341	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	1.13e-111	41	352	33	341	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	1.64e-108	41	352	33	341	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000015	1.000020	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_00781.