CAZyme Information: MGYG000003567_00445

Basic Information

• Species: Spiro-01 sp900769955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; Spiro-01; Spiro-01 sp900769955
• CAZyme ID: MGYG000003567_00445
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000003567_46|CGC1	53060.68	4.8516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003567	2372143	MAG	Fiji	Oceania

• Gene Location: Start: 12450; End: 13820 Strand: -

Full Sequence      

MYDRTWVWIEENWIQKPDDGLFANGYFVGSDSEVIDLFDSCLTSISLSYSNQNFDAYSLI
DFFYRMQKEDGQIFEKYDSKTYEPVVSDDNPRGVCPPLLPYVEFLFYHKIGNKKRLKEVV
PYLEKYFSFLASEYQCPNGLFHVPFSACRLGNVPRQNAYYTIDFNAMMALAALYMSNIGD
ILNDKELSFRYKRIYFSLKTRINSMMWDPEDKFYYDIDEDEKIVRNKHIGAYWTMLAEIP
NDEYADYLIDKLKDPAEFGTDNPFPCVPVSNPCFSEEGDGYRGGVVPFFTYMVIKGLGRY
DSFIFARECAIRHMYFILDTLHPDGEVVGDVWESYKPNKEGSSLSKDGSFVNRKHYLAML
SLVTVTLMIENIIGLEISLPRKTVDWTMTSLESMGIEKLSLKRNNITILSNKNTRGWEIR
LESEKLYYFTIMILDENKKKTLPIPSGKCSMLIDKL

Enzyme Prediction     

No EC number prediction in MGYG000003567_00445.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1626	TreA	2.59e-37	4	456	69	548	Neutral trehalase [Carbohydrate transport and metabolism].
PRK10137	PRK10137	2.11e-11	161	300	577	726	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.17e-05	161	259	304	403	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV29734.1	7.15e-216	1	456	19	474
ADY14846.1	1.58e-212	1	456	19	474
AEC03045.1	6.87e-193	1	456	19	477
QEN09064.1	1.12e-183	1	456	19	474
ADK79245.1	4.11e-180	1	456	24	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.59e-08	174	337	563	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.59e-08	174	337	563	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	5.93e-08	174	337	112	280	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	5.93e-08	174	337	112	280	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	5.95e-08	174	337	134	302	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	2.21e-136	1	456	19	474	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	3.09e-07	174	337	586	754	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003567_00445.