CAZyme Information: MGYG000003566_01343

Basic Information

• Species: F082 sp900769945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900769945
• CAZyme ID: MGYG000003566_01343
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		95753.46	5.1033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003566	1986649	MAG	Fiji	Oceania

• Gene Location: Start: 39402; End: 41906 Strand: -

Full Sequence      

MKKLILIITCLIPLLALSQETGIIPRPQQIDYHEGTFSWSKNESKNQKRIKTKIVKEIPA
KENESQSYIIDITPDRITLSATTEQGLFYARQSLSQMVRYQEVTNDGGKTELPCVTITDW
PSLEYRGWMDDISRGPVPTKEFIKKEIRTLAYYKMNFFQLYTEHLFKLESHPDIAPADGL
TAEEIKELSDYAKEYHVEFMGNQQCFAHAEKTLKIPFYDNIADTRHNFDPSKQETYTFLN
DVFQEVATAYESHYFNINCDETEGLGSGKAKSFVDEKGKDEAYCEHITKVYNILKEYDKD
IMMWGDIIGKNPSMIDKLPEDIQFVIWSYGAGDDYTEMLRPFKESGHTFWAATGASCWSL
AFPDIDTYMKNIANFSRDAYKCGAKGLMNTAWDDYGESMFNSTWHSMIWCAENTWNTSSG
LDYKDIFNNNFCIQFLNTKHNIVNDLLDLSNMKIPFAALNEPLLEFFPNQVSNQAINENK
NIQNKSLELYNRLRAIKEETPANKEFLECATNAAYRIYATATKNIFKAQLYTTLQAPCEM
NIIKTKELETQYVSILKELKHKSIRQWDAECRAYSRNIIESRFDKIMQDIINADKTVYIG
SKLTSGKPTITLNTIFNDKKIFYTTDGSEPNRNSNEYSMPFCIDRPCTVKAICYDEFDRS
CTTEKHFLYHKGMGHLKRLNSPAGNYRPEYSGGGDDALINGITGSNDYKDGKWQGFYGCN
ADIEIDFGKVETINSLTINFIANPFDWIMMPKTIKVYAFPTCMPSNMPDTFVKTFTFDDK
VPMSGNHIFTKTLQLGEIKTSYLRIVVENPGTLPEGTPGAGYDSWIFLDEIIIE

Enzyme Prediction     

No EC number prediction in MGYG000003566_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	124	417	1.1e-42	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	1.41e-72	125	416	1	301	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	4.80e-27	125	415	1	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.58e-20	124	347	2	255	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06564	GH20_DspB_LnbB-like	5.26e-20	124	339	1	232	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	4.70e-17	23	308	136	490	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOE22562.1	2.24e-168	63	834	98	886
AKJ64671.1	2.04e-78	57	419	100	458
QRQ48164.1	2.66e-77	66	480	113	519
QUT46231.1	2.66e-77	66	480	113	519
ACU05309.1	2.34e-74	61	575	105	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YHH_A	7.11e-18	64	313	90	375	X-rayStructure of Flavobacterium johnsoniae chitobiase (FjGH20) [Flavobacterium johnsoniae UW101],6YHH_B X-ray Structure of Flavobacterium johnsoniae chitobiase (FjGH20) [Flavobacterium johnsoniae UW101]
2EPL_X	1.26e-15	115	595	76	575	N-acetyl-B-D-glucosaminidase(GCNA) from Streptococcus gordonii [Streptococcus gordonii],2EPM_X N-acetyl-B-D-glucoasminidase (GCNA) from Stretococcus gordonii [Streptococcus gordonii],2EPN_A N-acetyl-B-D-glucosaminidase (GCNA) from Streptococcus gordonii [Streptococcus gordonii],2EPN_B N-acetyl-B-D-glucosaminidase (GCNA) from Streptococcus gordonii [Streptococcus gordonii],2EPO_A N-acetyl-B-D-glucosaminidase (GCNA) from Streptococcus gordonii [Streptococcus gordonii],2EPO_B N-acetyl-B-D-glucosaminidase (GCNA) from Streptococcus gordonii [Streptococcus gordonii]
6Q63_A	1.06e-14	51	833	91	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
5A6B_A	2.74e-14	115	421	98	427	GH20C,Beta-hexosaminidase from Streptococcus pneumoniae in complex with PUGNAc [Streptococcus pneumoniae TIGR4],5A6B_B GH20C, Beta-hexosaminidase from Streptococcus pneumoniae in complex with PUGNAc [Streptococcus pneumoniae TIGR4],5A6B_C GH20C, Beta-hexosaminidase from Streptococcus pneumoniae in complex with PUGNAc [Streptococcus pneumoniae TIGR4]
5A6B_D	2.74e-14	115	421	98	426	GH20C,Beta-hexosaminidase from Streptococcus pneumoniae in complex with PUGNAc [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96155	1.41e-10	67	320	209	505	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
P13723	3.75e-10	66	261	101	308	Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1
B2UPR7	1.47e-09	66	330	182	467	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
P49009	2.75e-09	66	312	129	392	Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica OX=5759 GN=HEXA PE=1 SV=2
Q54SC9	3.49e-09	66	261	109	314	Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum OX=44689 GN=hexa2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000441	0.998712	0.000323	0.000168	0.000166	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003566_01343.