CAZyme Information: MGYG000003556_00322

Basic Information

• Species: Alistipes sp900769745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769745
• CAZyme ID: MGYG000003556_00322
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000003556_59|CGC1	53206.35	6.3492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003556	2131277	MAG	Fiji	Oceania

• Gene Location: Start: 25909; End: 27309 Strand: +

Full Sequence      

MRRFLTFFLALLFAEVAFSQEIIVHRQDIVGEIKPMNGVNNGPKSPESYDGQDLDNFEAY
RAAKFPYARTHDAALCENYGGSQAVDITGIFPNFDKDARNPKNYNFALTDRYIKFIIEDG
GSQVFFRLGQSIENHGEKKGAYPPKDFKKWATICEHIIRHYNEGWADGFHYNIVYWEIWN
EPDLDKYDWWTSPKTWGGTAESFFELYTITTRHLKKCFPNLKIGGPALAGYEDWAEEFMK
HMSANKVPIDFFSWHIYATKPQDIVGKANRMRALCDKYGYTQTESILNEWNYIKNWTKDF
PYSIATMSAVKGAAFVAATMSACQDVSVDKLMYYDARPYTLFNALFDFYTQKPLPPYYSL
YAWSHLSRYGKQAKVSIAGENAGDLYATAAISPAGALRLLVTRYNDDNNVIRDKQVKINL
GDNFTGEVMGYLIDSARIYTEIPITVKAGIAEVTLEPNAVLMIVAM

Enzyme Prediction     

No EC number prediction in MGYG000003556_00322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	97	420	1e-45	0.7795823665893271

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.67e-24	42	260	28	229	Glycosyl hydrolases family 39.
cd21510	agarase_cat	1.06e-07	134	257	63	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD85864.1	1.31e-78	21	463	3	445
QJD82796.1	1.61e-74	31	412	12	387
QTH43246.1	2.40e-73	31	412	12	387
AVM69820.1	1.40e-70	22	460	3	443
QEL16017.1	1.71e-70	21	336	26	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z3K_A	3.89e-36	21	336	8	304	Crystalstructure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus],5Z3K_B Crystal structure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus]
6YYH_A	2.14e-19	86	302	82	291	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
1PX8_A	1.13e-17	65	260	48	233	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6UQJ_A	1.45e-13	65	312	61	315	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
4EKJ_A	5.47e-11	175	291	157	282	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	3.47e-17	65	260	48	233	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	8.24e-16	65	260	48	233	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	1.37e-13	103	259	79	233	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000195	0.999204	0.000147	0.000146	0.000141	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003556_00322.