CAZyme Information: MGYG000003556_00173

Basic Information

• Species: Alistipes sp900769745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769745
• CAZyme ID: MGYG000003556_00173
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000003556_36|CGC1	38837.13	6.5912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003556	2131277	MAG	Fiji	Oceania

• Gene Location: Start: 4786; End: 5802 Strand: +

Full Sequence      

MIFYRKATYWAIFALLICAFQANAQTRQTKEEYIERYKHIAIDHMERYGIPASITMAQGI
LESDSGNSNLARRSNNHFGIKCKKNWTGQRVYHTDDAPDECFRKYDTVEESYEDHANFLD
QSPRYDSLFAYEATDYRSWARGLKAAGYATAPDYAQRLTKIIEDNNLYLLDQENGASLYS
SRFREKATEAAQEFEQSSSVNTPVTTESRVDPNDYRVVERTYNGFSVYANNGSHFVIART
GDTFEQIAETFGLTPHSIRKYNEIDAKSTADPIQGEKIYIERKQNRWNGEQTTHRVMPGE
TLQSISQEYGIRLSKLAAMNKLKDDSPLQLGGHIILRK

Enzyme Prediction     

No EC number prediction in MGYG000003556_00173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	167	8.9e-39	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.09e-39	30	178	43	195	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	3.01e-34	4	171	134	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	5.19e-28	38	167	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	2.19e-24	31	163	9	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	6.96e-20	46	162	168	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL04344.1	9.92e-132	23	337	19	332
BBL13853.1	1.41e-131	23	337	19	332
AFL77234.1	1.59e-126	15	337	13	335
BBL09489.1	3.20e-126	15	337	14	335
BBL12282.1	3.20e-126	15	337	14	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.16e-15	49	167	20	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.41e-15	49	167	21	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.51e-15	49	167	21	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	2.14e-09	46	163	19	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.78e-09	46	163	19	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.37e-16	46	228	64	258	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	7.41e-13	31	161	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	9.08e-13	29	168	160	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P37710	2.74e-12	22	338	166	474	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9I4P4	1.42e-09	31	168	240	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000847	0.883278	0.115066	0.000278	0.000252	0.000234

TMHMM  Annotations     

start	end
7	24