CAZyme Information: MGYG000003548_01740

Basic Information

• Species: QALS01 sp900769545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900769545
• CAZyme ID: MGYG000003548_01740
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		58504.07	9.2329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003548	2291640	MAG	Fiji	Oceania

• Gene Location: Start: 4055; End: 5611 Strand: +

Full Sequence      

MKKTPTVYICILSVWAICAGVLLFSCGQLIYGVVQGDNVTGKAIVVAVLLALNAVMLAYM
WLGSVKDFMFSLLFLFMGKRLMKRYKPILNGELPKKQPKFLLLYCTCNDFNGDALKECMG
QEYDNFETVILDDSSQKEYKEQIDEFAQKHGVRVVRRQDRKGFKAGNLNNYLQGKTDYDY
FVVLDSDERIPADYIKETLRYFVYDENVGVVQAAHKATKGSNLFQSLMGLSVKSNGKICQ
VMKNFYGSNALIGHGMAIRRECFEAVKGFPEVVAEDISFAVDVKNSGYRVLYAPNIVCKE
EFPVNYLCLKKRQAKWVQGNVEFMKKYNRSITDSKMTWYERLDIRLSHYNLPIIPMLSFM
LIINTVIMGFLGFDVGRYSLTLVGLMLLFLVSPLIPDFFVHGKEKNFVRLIGYAFLNFVV
YASLVPMMIGTVLLALFGKKAKFIVTPKEERRISVREAVRGSVDSILFAVIVGILTYGTY
FSFAPTVLIVLCCALTPIAILAANVPAENAKCEMRSAK

Enzyme Prediction     

No EC number prediction in MGYG000003548_01740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	113	317	2.8e-25	0.908695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.81e-32	50	434	4	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	3.91e-31	98	322	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	4.03e-23	112	276	13	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06435	CESA_NdvC_like	1.75e-20	122	327	25	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	1.00e-18	124	319	31	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC01535.1	4.92e-176	1	518	1	521
QDL20008.1	9.88e-176	1	518	1	521
QDL19322.1	9.88e-176	1	518	1	521
QIN44161.1	9.88e-176	1	518	1	521
QIN44840.1	9.88e-176	1	518	1	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.59e-07	137	324	187	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.65e-07	137	324	199	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.65e-07	137	324	200	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8LIY0	4.41e-19	125	361	264	512	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q9SRT3	7.44e-18	82	361	195	500	Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=CSLC6 PE=1 SV=1
Q84Z01	1.27e-16	125	361	259	507	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC10 PE=3 SV=1
A2YHR9	1.27e-16	125	361	259	507	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC10 PE=3 SV=1
Q9ZQB9	1.29e-16	130	361	277	520	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.902444	0.002075	0.094187	0.000014	0.000008	0.001265

TMHMM  Annotations     

start	end
4	26
43	65
351	373
378	400
415	437
458	480
485	507