CAZyme Information: MGYG000003547_00417

Basic Information

• Species: UMGS1976 sp900769535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1976; UMGS1976 sp900769535
• CAZyme ID: MGYG000003547_00417
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737		83983.56	4.5541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003547	1366229	MAG	Fiji	Oceania

• Gene Location: Start: 255; End: 2468 Strand: +

Full Sequence      

MWITDKRAEQKADGLFYFKKRFNYTEGNLVARVSADTRYKLFVNGREVICGPSKGNRFVT
YYETADLTPYLTVGENEILALVLHLNYRMASVHRTERTAFLFDGQIVGESGVIEDISSDD
SWVSAPDPSFICTAPDYWCFTDFTERIDYTAEGSEFMPCEKICDAVFDNDYPYGEMATWR
LKEREIPQLTNTERKFVRVMRSDATDGDILSENGISVEPNTTAYIELDAGVHFTGTPHLH
IKGSKGASIKITYAESYIFKDGWRITKKMRDDTDGIIYGMTDELILDDEAHVYEPFWLRT
FRFIRIEIISAESPVYISDLKFFENKYPLEVSARFDSSDLDSAPLWENSIRTVNNCMHET
FEDCPYYEQTQYAMDSRLEMLFTYHLGADRRLAKKGLNEFFLSQYPDGMTQARFPSLSEQ
VIPGFALHVVYMAEDYLRFTPTDRKFVRTLMPKIDAILSWFDRLVDERGVVADTGYWRFL
DWVKGWRDGSPGKGAMAAYSFMYALALKKAADMCTAFGYNDLAAEYTDRAERINSSAKEY
FYDTERQLFTDTENGGFSQHAQVWAVLSGAVSGDEATALMTRMLDDAELPICSYSMRYFL
FRALETAGLYDRAYGLLDGWRDMIKRGLTTWAEDDVQERSDCHGWGSLPIYEFSAVILGV
RPIGYDGKAVEIRPTLAGLEYANGVVSTPLGDIDVDWTAKDGRFTISVSGNGEKRVTLPD
GTTHIITEEKATLFCAI

Enzyme Prediction     

No EC number prediction in MGYG000003547_00417.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	226	709	5.7e-104	0.9583333333333334
CBM67	2	149	2.7e-24	0.8068181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.37e-13	335	646	6	329	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.93e-09	659	730	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.37e-04	430	542	345	462	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam08531	Bac_rhamnosid_N	0.001	39	122	16	110	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17167	Glyco_hydro_36	0.002	486	580	190	296	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH24613.1	4.39e-168	2	728	11	794
BBI31976.1	1.12e-167	15	724	28	786
QTH43327.1	8.41e-164	2	728	11	790
QTH40607.1	3.09e-163	2	724	11	763
QGQ95546.1	7.61e-163	2	737	11	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.21e-35	299	730	503	953	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.92e-11	349	651	223	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.07e-12	17	709	172	867	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003547_00417.