CAZyme Information: MGYG000003544_00352

Basic Information

• Species: Alistipes sp900769525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769525
• CAZyme ID: MGYG000003544_00352
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		47441.81	5.9869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003544	1583718	MAG	Fiji	Oceania

• Gene Location: Start: 20; End: 1231 Strand: +

Full Sequence      

MAYHYFVQYHLSKQLREVRDYAHANGVVLKGDIPIGISRTSVDAWVYPELFNMDSSAGAP
PDDFSVMGQNWGFPTYNWAKMAEDGYAWWKARFVKMAEYFDAYRIDHILGFFRIWEIPLD
AVNALLGRFNPALPYSVDEIRGYGFNFEHWHVGNIAETDNMLFVEDKLKQGHYHPRISAY
NTDCYRWLSNEQKEAYNRLYNDFFYRRHNDFWQWEALKKLPPLTEATRMLVCGEDLGMIP
DCVPSVMSGEQILSLEIQRMPKDPKVEFGSTYDYPYLSICTTGTHDMNPLRAWWEEDRGV
TQRFYNQVLGAWGDAPYFCEPWIAEQVISMHLKSPAMLTVLPLQDWLAMDGELRRENPHD
ERINVPANSRHYWRYRMHMTLEELLKADNINKLIRHKIAESGR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	2	396	1.8e-106	0.6214574898785425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	5.84e-158	1	386	449	901	4-alpha-glucanotransferase
pfam02446	Glyco_hydro_77	1.12e-134	1	380	172	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN03236	PLN03236	2.55e-129	3	403	264	741	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	4.10e-77	3	395	200	510	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	9.99e-68	3	395	188	492	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62792.1	1.31e-186	1	403	407	866
QCD41142.1	5.46e-186	3	403	427	892
ASB36857.1	6.17e-185	6	403	430	892
ANU62654.1	6.17e-185	6	403	430	892
QQR10009.1	6.17e-185	6	403	430	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X1N_A	2.43e-29	8	403	217	523	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	3.39e-29	8	403	269	575	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
2X1I_A	8.21e-28	1	377	182	477	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1TZ7_A	8.53e-28	3	377	197	483	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
2OWC_A	6.12e-26	1	377	185	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXD9	5.29e-119	1	403	458	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q69Q02	1.21e-118	1	403	452	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
O34022	4.02e-40	6	391	214	520	4-alpha-glucanotransferase OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=malQ PE=3 SV=1
Q9PKU9	1.94e-39	6	394	214	523	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
Q9Z8L2	1.18e-36	6	384	210	509	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003544_00352.