CAZyme Information: MGYG000003543.1_02081

Basic Information

• Species: HGM04593 sp900769465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900769465
• CAZyme ID: MGYG000003543.1_02081
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1158		127022.33	4.3462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003543.1	3216165	MAG	Fiji	Oceania

• Gene Location: Start: 35411; End: 38887 Strand: -

Full Sequence      

MSSPLLIGCDMNDIKGNALELMQNKELIALNQNTLGLQAYVAKRENGGYVLVKDVEGKYG
AKRAVAFYNPTNSAIDMSISFSQLDLAGEVAVRDLFEKKDKGVYEGSYSVTVPAHGTRIY
KLDAEQRLERTLYEAETAWLTDYQEIKNNEVYGTAIYTEKSNCSGGMAVGWLGNRDSNDL
QWRNVYSREGGEYTVRVFFITGENRTMKLSVNGGEPQVYTGNSGGWGTVGSAEFDVVLEK
GENVVRLFNESGYMGDIDKMVLVNKNVPVVTEDYPIVFDKSQGYTHGSRRLNSVSLSGQT
LQLPTPLKVYSKIDNPTFHAVAGETVTPSFGFTGTWMNGFVYVDRGQDGAFEAKLNADGS
IPAGSDIMAFSYAEPSLGSGTGYNSNGERVSNTNVLNPPAFRVPADLAPGFYRMRYKVDW
ASIDPAGRAEDGNGILQNGGAICDVVLNVHNDNGAFSVVAENGALLAADGSALPATVPFG
EALVLTVNPAEGYVLDAVKVLHGHNFDDDEVLHGVQQYREDIISGTLVTDGKVIIPAEYI
DGDVVITAVFANAAGGVGGDGYALSFDKDAQVPGEHRYLVLFNNMDMSPSGPDTYRDAYR
VATDEDQTGSYTLEGTRDIDVIIENFAGEDIKNVYMYIDLNNDGKFVALLNEDGLPAMSS
ELVAFSCHNGIDSEGNPAQKGAVAILPTVVLDDAIPAGVYRMRLKLDTDNINPGGSENFV
AENGLIIDYLISIAGDKRRLTLHTVDGSIDGVDNTALPMMVENNEMITYVLRGAPGYKCN
KVIVRHGYNLDGEQYVNGNLQWREVEEKVNVNAREHLVPAWCLDGDVALFAEFEPEEGCE
WQLVFSDEFNAADMSQPVDEKWMRCQRYGATWNRWLSDSKEVIYLQGGDLVARAIPNPDQ
ASDPVPMITGGIKSNNRFGFTYGYVEARIKSNPWTGNFPAFWMMPEDQSAGWPDCGEIDI
WETIDSQERSWHTVHSNWTYDLGNTNNPKSSFNVATSHDRYHTYGLMWDETSLVWYVDGK
EVGRYAKSTNQSQLNQGQWPFDKHFHLILNQSVGNNAWAADADVTHTYETRFDWVRVYQT
NGMENTNGTVGVVSVREDADATVQVVDGGVEVSVAAPCDVEVYDVAGRKVAAAFVNGTHS
FALSRGVYMVEGVKVVVK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	846	1078	6.1e-49	0.991304347826087
GH27	1	101	1.2e-19	0.40611353711790393

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	9.17e-59	845	1078	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.82e-29	847	1078	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd04081	CBM35_galactosidase-like	2.77e-27	131	262	1	125	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd02178	GH16_beta_agarase	3.32e-23	837	1079	15	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	1.53e-22	822	1103	30	291	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13169.1	8.82e-97	269	1079	20	541
BBA29449.1	1.18e-75	838	1156	45	333
QUB68183.1	3.07e-75	824	1156	32	333
QUB61503.1	4.23e-75	838	1156	45	333
QUB63276.1	4.23e-75	824	1154	32	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	6.66e-32	840	1079	28	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6JH5_A	5.98e-25	841	1085	4	238	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	3.74e-24	841	1085	4	238	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
2VY0_A	8.16e-24	837	1078	9	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
4CRQ_A	1.82e-21	840	1079	2	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	1.37e-35	840	1093	55	302	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	7.11e-23	841	1079	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	6.14e-19	843	1079	425	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
O33680	4.78e-14	845	1078	222	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	4.54e-13	845	1078	222	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999714	0.000179	0.000137	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003543.1_02081.