CAZyme Information: MGYG000003532_00644

Basic Information

• Species: W0P28-013 sp004557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; W0P28-013; W0P28-013 sp004557405
• CAZyme ID: MGYG000003532_00644
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000003532_15|CGC1	31444.13	5.414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003532	1885895	MAG	Fiji	Oceania

• Gene Location: Start: 15147; End: 15971 Strand: -

Full Sequence      

MREPVKVLFIVQELMPYLPETVVSRLCRELPQYVQEQGCEIRIFMPCYGVINERRNQLHE
VQRLSGMNLIIDDSDHPLIIKVASLPSARMQVYFIDNDDYFRRRGTTVDTDGKEFGDNDD
RMIFFARGVLETIKKLRWTPDIIHCHGWMTALIPLYMRTAYRDDPFFQDAKVLYSVYNNA
FTSQFGKEFAKHLITKGVSAADVKTVKTAKVDYDAVTRLAIEHVDVVDAADAEVSDMPAT
AAAACGVRFAPYAEDYKRKYMQLYAELCPAIELD

Enzyme Prediction     

No EC number prediction in MGYG000003532_00644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	6	193	5.1e-45	0.3771186440677966

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.69e-55	7	193	1	182	Starch synthase catalytic domain.
PRK14098	PRK14098	3.08e-53	2	227	3	224	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	3.85e-39	6	193	1	181	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.59e-32	6	188	2	165	glycogen synthase GlgA.
COG0297	GlgA	2.36e-21	6	190	2	178	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ79449.1	1.51e-99	1	267	1	269
QDO69344.1	2.74e-96	6	225	6	224
BCI63199.1	1.57e-95	6	264	5	265
ALJ61464.1	3.16e-95	6	225	6	224
QUT92962.1	3.16e-95	6	225	6	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	1.29e-07	7	186	3	172	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	4.27e-06	30	156	35	156	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.04e-42	2	178	3	180	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	1.45e-42	2	178	3	180	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4SC83	1.45e-42	2	178	3	180	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
Q3B6C3	2.02e-42	2	178	3	180	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
Q3APL6	7.72e-41	2	200	3	202	Glycogen synthase OS=Chlorobium chlorochromatii (strain CaD3) OX=340177 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003532_00644.