CAZyme Information: MGYG000003528_02492

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_02492
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		97168.65	6.6963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 164; End: 2755 Strand: +

Full Sequence      

MQTYHVAAALLSLLACGATTLAALPPVPPTGEEAARTLVLADPSRAHDWDGGAPDPSVAR
EDIPVTVRWQPARARTLTLRNVPRDWTGGPWNTIEFWLHSAKATPGRCLLYIGSENPGTD
GMDYYSAFLQLDFAGWRRITIPLNELSLSRQPRGFDAIDAVRLTTAGWNLTAHPDTDLHV
GPIVLRYLKPATGPVTSDEELFSALDLDRPDLQDVREAVGRQDWLTAKQAFVRHLKTRER
PVWHFDWRTSGTPAVRRPGYHNQTAEDACRNLLTSCSFPHQFGEHIDWSINPTPIKYAEW
TWQLSRHPFWAALGQAYRFTGDEKYAEAYVRQIRGWIIDNPLPRSAANGVGSRWRTIESG
IRTASSWPDAFFACLNAKAFDDDSIIMVVKSFYEHALHLREFPTSNNWLCMEMNGLYHIG
TIFPEFRQAQEWRDYAAKRLYDEMDIQVYPDGAQRELAPGYHGVSLHNFLGTYRIAKLND
QPLPADFIPRLERMYQTYLNYCSPTGCMPALNDSGWGNVRSLLQQGHELFPHRTDFLYIA
TQGRQGTLPTFTSNFMPYAGWYNLRSGWGPLDLFCNFEVGPFGAGHQHEDKLSFNLYAYG
KRLLTEGAIYAYDTSQWRKYVLSARAHNVTRVDGLDQNRREGGPFNTIDQPLTNRFLTTP
VFDFAEGRYDEGFGRGRKLKVSHTRSILFVKPHYWLVLDVMTPPDDQPHTYESWFHLNTA
RADILPDLKAAVSTDPTSANLLILPLNPASLDLRLITGQEKPEVQGWIAQNTYKTIPVAT
PTFTAKAAGQLLLPYLFLPLQPGQDNPVAGVDHSAPDTFVIRFADGAQDTLTAVPNPADG
TIRRLTLVRQSPAGAITTLSVID

Enzyme Prediction     

No EC number prediction in MGYG000003528_02492.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	560	699	8.3e-27	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16889	Hepar_II_III_N	1.83e-97	202	538	1	344	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam07940	Hepar_II_III	5.69e-21	549	742	2	182	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam05426	Alginate_lyase	0.006	311	483	62	246	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF90891.1	1.72e-140	182	837	20	701
AHF90266.1	2.05e-133	200	838	44	698
AHF92618.1	3.67e-133	200	831	85	737
AVM45511.1	1.79e-125	199	823	40	657
AHF91117.1	3.84e-123	189	850	415	1104

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JMD_A	4.06e-47	200	699	17	522	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
4MMH_A	1.16e-46	202	699	10	502	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	1.16e-46	202	699	10	502	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
5JMF_A	1.09e-45	200	699	17	522	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]
4FNV_A	1.30e-35	172	699	19	565	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C7EXL6	6.26e-46	183	701	8	535	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1
Q59289	7.76e-46	202	699	34	526	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
Q89YR9	7.11e-35	172	699	19	565	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.013799	0.512716	0.470461	0.001900	0.000576	0.000527

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_02492.