CAZyme Information: MGYG000003528_01769

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_01769
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		70462.56	6.9892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 6838; End: 8718 Strand: +

Full Sequence      

MKMTPLCLLACAGAPLLFAQTTPKLDEAYGICAHVSRGEIKYAVPSFDRMNEAGMTWART
DYDWSRIQPEKGKWVFEHLDALHKLAKEHRVKILPILGYNTKFAPIAWKDLDAWCEFVRR
LAERYQNDLPHWEIWNEENLRGFWKDVPDGANYAKLLLATYKTIKAVNPNLTVVYGGTAG
VPLKYIEDSLKAGAADGFDAIAIHPYKWTGIPEHMLKDFDDLKALLAKYGAAHKPIWITE
VGWSTALAPKKYEGVFNAAFRHLGLKEKQAPIAIVYDSRYQLGVSSTLRSPDYTSFFSGE
HRITLDDIAALDPATYPVLLPCLNESFPSTDYLPAIKAYLAKGGTLLLPAGLPFYYDLLR
EPNGAITKRQVNDTFLPQLHMSTETWWTKKGVPEKETYQKPGPAFEGQFTIGKLDPTWRF
FTAENLKPGDEFVPLVSAGTDTYHSQIAAIYKLRSDGLNGNIIAASFSNFIETVPEEVQA
RHLPRTYLLSFASGVEKVLWYNLRAAEWDMHEREACFGIVNAKVEPKPAFQTYKTLYALC
PNGSTRPELTADKERNRYVVSWSDPAGQRCWAIWNSRQDETVRLTVKGTIAKTLDDFGQT
LPNPTDTLAIGTRIVYLVGPDSVTIE

Enzyme Prediction     

No EC number prediction in MGYG000003528_01769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	109	263	1.2e-31	0.41067285382830626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	3.87e-11	37	260	36	290	Glycosyl hydrolases family 39.
pfam02449	Glyco_hydro_42	1.71e-04	47	137	16	137	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam11790	Glyco_hydro_cc	0.002	149	240	85	168	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	4.17e-219	9	626	9	617
QDU57372.1	5.96e-106	29	626	30	631
AVM44901.1	8.42e-64	12	538	7	547
ACL23641.1	6.55e-33	19	261	33	288
CCW36010.1	1.32e-32	50	247	51	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	2.59e-18	48	367	40	353	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	2.59e-18	48	367	40	353	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
5JVK_A	3.15e-17	30	277	107	377	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
1W91_A	2.72e-09	93	260	121	298	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	2.72e-09	93	260	121	298	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	2.60e-08	93	260	121	300	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	9.60e-07	109	244	125	281	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	8.84e-06	109	244	125	281	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000417	0.997740	0.001275	0.000194	0.000180	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_01769.