CAZyme Information: MGYG000003528_00535

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_00535
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000003528_77|CGC1	51857.92	5.5051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 9035; End: 10444 Strand: +

Full Sequence      

MKVAIIGAGSLVFCKTLMLDIMQIPGLDGVEFSLMAPTTRHTSCVKRHMDKVLALGKLSC
PVSISVTTDRREALANADYVICTFKIGGLRAYEADIEIPLKYGVDQCIGDTLGPGGVFRT
LRTVPVMREVAAEMRELCPKALMLNYVNPMATCCWAVADEGVQVVGLCHGVQTTLELLAG
YAGVPKDEIDYTCAGINHMGWFIRLEHHGQDLYPILRERIERPEYYANEKVRGEMFRQFG
YFMTESTGHLSEYLPYFRKNDRGMGLYCDEPDFGGETAACLKWNRLLDRKYAADDRLANE
PVELPPRSVEYCSYIIEALEKNRVFRFNGNLRNHGLIANLPDDCIAEVPIFADGAGLHPT
YVGKLPTQLAALNQSNISCQRLAVEAALSGDPEAAVWACALDPLTAARLTPDEIRAMVTE
MLAAEAEWLPQFGGRLPRPTPRITVTPDVQRVRVPLDPALAISARLGSL

Enzyme Prediction     

No EC number prediction in MGYG000003528_00535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	179	1.3e-53	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	1	422	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	432	2	430	alpha-galactosidase; Provisional
COG1486	CelF	8.90e-135	1	432	4	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	7.50e-66	1	429	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam11975	Glyco_hydro_4C	2.50e-60	193	405	1	168	Family 4 glycosyl hydrolase C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK60298.1	4.95e-228	2	469	3	468
QHW32897.1	4.44e-224	2	469	3	468
QGQ94557.1	2.09e-222	2	469	3	468
QHT63155.1	4.21e-222	2	469	3	468
QTH40102.1	4.61e-219	2	469	3	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	3.04e-42	57	432	61	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	5.52e-39	57	432	64	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3FEF_A	1.03e-33	71	404	70	420	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1OBB_A	1.21e-25	2	423	5	466	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
7BR4_A	4.53e-24	1	358	13	404	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X4Y0	2.49e-103	2	433	5	443	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
O34645	5.18e-90	2	432	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	4.81e-86	2	435	6	451	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	1.16e-83	2	435	6	451	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
A9KTB9	4.71e-43	2	431	12	462	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_00535.