CAZyme Information: MGYG000003524_00635

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177
• CAZyme ID: MGYG000003524_00635
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37091.85	5.395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003524	1517347	MAG	Fiji	Oceania

• Gene Location: Start: 96; End: 1076 Strand: +

Full Sequence      

MRAGKHVAIEVGGAASIEECWQMVRASEETGKFCMLLENCCYDRKEMALYNMVKKGLFGE
IIHMQGGYEHDLRDEISLGRENRHGRLFNFQHRNGELYPTHQLGPISKVLNINRGNRFIS
LSSTASKSRGLNEWIKKNKGEDYDIADYHFNQGDIVTTVLKCADGETVVLTHDCSLPRPY
SRAYRIQGTKGIYMEDGNTIYLEGVSHEDENHWTHTWESFDPYLEKYEHPLWKKYKIDGV
HEGGHGGMDFLVLSAFAESVRLDAAPPLDVYDTAVLMAVTCLSEQSIAIGGAPVPFPDFT
NGMWIDREPYRRGIFCLNEVCEDCFE

Enzyme Prediction     

No EC number prediction in MGYG000003524_00635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	305	3.9e-123	0.7518796992481203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.69e-07	1	288	88	333	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95391.1	6.91e-146	1	326	96	414
QTH41090.1	1.42e-138	1	305	97	394
AVM67823.1	1.88e-136	1	326	88	414
ANY74959.1	1.91e-134	1	308	99	399
AEF80535.1	1.81e-132	1	325	95	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.42e-95	1	319	112	442	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.22e-62	1	309	134	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8G1	3.64e-100	1	309	144	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	7.89e-96	1	309	141	462	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8F7	1.87e-94	1	319	112	442	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	3.21e-86	1	309	127	446	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	2.26e-79	1	309	136	437	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003524_00635.